KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_493130Help
Entry
ARALYDRAFT_493130 CDS       T01578                                 

Definition
palmitoyl protein thioesterase family protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aly01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:aly00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 304 aa AA seqDB search
MEKSFLRSTLLVTLTIFFFLPVSISVPFILFHGIRDQCSNGGVSSFVQLLSNLSSSPGSC
LEIGDGEQDSVTMPLTQQASVACEKVKQMKELSQGYNIVAQSQGNLVARGLIEFCDNAPP
VFNYISLGGPHAGISDIPKCNSTLCELLKTEVYTDFVQDHIAPSGYIKIPTDIKNYLEHS
KYLPQLNNERPKERNATFKDRFTSLHNLVLVMFDGDTVVIPKESSWFGYYPDGASTPLLS
PQETKLYTEDWIGLKTLNTAGKVKFVSVHGEHLRIAQDDVVKYVAPYLKNQPASMSEDLE
ILHL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggagaagagtttcctaagatctactctccttgtgacattgactatcttcttcttcctt
ccagtttcaatctcggttccattcattctctttcatgggattagagatcaatgctcaaat
ggtggagtgagcagcttcgtacagctccttagcaacctctctagctcccctggatcttgc
ttagaaataggagatggagagcaagattcggtgactatgccgcttacgcaacaagcaagt
gtagcgtgtgagaaagttaaacagatgaaagagttgagtcaaggctacaacattgttgca
cagtctcaaggaaacttggtagctagaggtctaatcgagttttgcgacaatgctcctccg
gtcttcaactatatatctttaggaggtcctcacgctggcatatccgatattcccaagtgt
aattctacgctttgcgagttgctgaaaacagaggtctacaccgacttcgtacaagatcat
attgctccaagtggttatatcaagatccctaccgatataaaaaattacctggaacactcc
aagtatctgccacagctcaacaacgagagacctaaagaaaggaacgccacttttaaagac
cggttcactagcttgcacaacttggtccttgtcatgtttgacggtgatacagtagtgatt
cctaaagaaagttcttggttcggatattacccggatggagcttccacacctcttttgtct
ccacaagagacaaagctctatactgaggattggattggtctgaaaaccttgaatactgcc
ggaaaagttaagtttgtcagtgtccatggcgagcacctaagaatagcgcaagacgatgtt
gtaaaatacgtcgcgccttacctcaagaaccagcctgcgtctatgagtgaagatttggag
atactgcatctatga

DBGET integrated database retrieval system