KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_493174Help
Entry
ARALYDRAFT_493174 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:aly03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:aly03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 452 aa AA seqDB search
MPQVKIIAKNFMDMVASLPAIKLDKLYNNVFICEAILRSLPPLAKKYVLQMLYINVPVPA
AMMEEWVLADGASKHRVAIDRLIQLRIFSETSDRKRGISYSLNPTFQNNLQKHIISGGVL
PREPMHSDNAIKLPSLQELETYALKQWECFLLQLINSGQGEKLTGISSSMMRIFQRGLLS
QRDKDGPRLTESGFQFLLMDTNAQLWYIIREYISNAEERDVEPADLISFLLELSFHVTGE
AYNSNTLTEVQNNTLKDLADLGLVKLQQGRKDSWFIPTKLATNLSVSLADSSARKEGFVV
METNFRMYAYSTSKLQCEILRLFARIEYQLPNLIACAITKESLYNAFDNGITSDQIITFL
QQNSHPRCADRVPSIPENVTDQIRLWETDLKRIEMTQAHFYDEFPSKDVFEAACDFAREW
GGLLWEDSKRMRLVVKSEVHNQMREFLHNQTK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagttaagatcattgctaaaaatttcatggacatggtggcgtcacttccagct
atcaagcttgacaaactctacaacaatgtctttatctgcgaagccattctcaggtctttg
ccgcctcttgccaagaagtatgtattgcagatgttgtacattaatgttcctgtacctgct
gcgatgatggaggagtgggttcttgcagatggtgcctccaagcatagagttgctattgat
cgactgattcaattaaggattttttcagaaactagtgataggaaaaggggaatcagctac
agcctaaatcctacatttcagaacaatcttcagaaacatataatttccggtggagttttg
cctagagagcctatgcattccgacaatgccattaaacttccaagcctacaagaactcgaa
acctatgcacttaagcaatgggagtgtttcttgctacaacttataaattcgggtcaaggt
gagaagctaactggcatcagttcatccatgatgagaattttccagcgaggtttattgagt
cagagagacaaagatggcccgagattaactgagagtggctttcagtttttgctgatggat
acaaatgcccagctttggtacattattcgagaatacatatcgaatgctgaggagcgagat
gtagaaccagcagacttgatttcgtttttgttggagcttagttttcatgttactggtgag
gcatataactcaaatactttgacagaggttcaaaataataccctcaaggaccttgcagac
ttgggattagttaagcttcaacagggaaggaaagacagttggtttattcctactaaactg
gctacaaatttatcagtcagtctggcagattcatcagcgcgaaaagagggatttgtcgtg
atggaaacaaacttcaggatgtatgcatactccacatctaagttacagtgtgaaatttta
cgactgtttgcgaggatagagtaccaacttccaaaccttattgcttgtgccattacaaag
gaaagtttgtacaatgcatttgacaatggcatcacatcagatcagattataactttcctc
cagcagaattctcatccacgatgtgctgatcgggtcccatctattccagaaaatgtcact
gatcagattcggctttgggagacagatctgaagagaattgagatgacccaggctcacttc
tatgatgaatttccttcaaaagatgtgtttgaggcagcgtgtgactttgctcgggaatgg
ggaggccttctttgggaagactctaagagaatgcgacttgttgtgaaatccgaagttcac
aatcagatgcgtgagtttcttcataaccaaaccaagtga

DBGET integrated database retrieval system