KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_493270Help
Entry
ARALYDRAFT_493270 CDS       T01578                                 

Definition
At4g16144
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aly04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 507 aa AA seqDB search
MKIDLNKVARKIEVDNRIPLRNYYRIADNLLRQASIYREEKNVVDLYIMLLRYSSLISET
IPFHRDYQASLPQERLGSRKRLRAVINELESLKPEFNRLVDKLNRVEDESRLVGSDLPIV
SYSSDAVEWPPAHKASYSGPDINKPLPTSQPSWTYNNNLTSSSNRTQIDQQFQKLSFDFL
PPNQATLSRHSFLGPNGLKSQWVAPKSEIKVQYPSNTDWGSADNSGLIEAGPSGSSASHN
GDSQEVSTLNSVLSLDDGRWQQHSEAVNSQFISDATEDPFQFVGMKQPSPPPVLAQVHQE
LAQICPSKVADPRPGPAIPSLEGKEGSNSYQHLHVPVRIMDDFLRLARSNTERNLETCGV
LAGSLKNRVFHITTLIIPKQESTSDSCQTLNEEEIFEVQDRLSLFPLGWIHTHPTQTCFM
SSVDLHTHYSYQIMLPEAVAIVMAPTDESTPHGIFHLSDPSGVSVIRNCQQRGFHPHEES
EDGNPIYEHCSHVFLNAKLKYEVLDLR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgatctgaacaaggtggctcgtaaaatcgaagtcgataatcgtatccctctt
cgtaattactaccgtatcgccgataatctcctccgacaggccagtatatatcgggaagag
aagaatgtggtggatttgtatatcatgcttcttagatattcaagtttgatttctgaaaca
attcctttccatcgagattaccaggcatcgcttccacaagaaagacttgggagtaggaag
aggttgcgtgctgtaatcaatgagctcgagtctctgaaaccggaattcaaccggctagtt
gataagctgaacagagttgaggatgaatcccgtctggttggaagtgatctcccgattgtt
tcatatagttcagatgctgttgagtggcctcctgctcataaagcttcatactccggacct
gatattaacaagcccttaccaacatctcaaccatcctggacgtataacaataatctgaca
tcatcttcaaatcgtacacagatcgatcagcaattccagaagctatcttttgattttctg
cctccaaaccaagcaaccttgtcaaggcattcatttctaggtccgaatggtcttaaaagt
caatgggttgcacccaagtcggagataaaggttcaatatccgagtaatacggattggggt
tctgcagacaattctggtttaattgaagctggaccaagcggttcctcagcatcacataat
ggtgattctcaagaagtctcaacgctgaactctgtgctctccttagatgatggtcgatgg
cagcaacattctgaggcagtaaattcccagtttattagtgatgcaactgaagacccgttt
cagtttgtcggtatgaagcaaccttcccctcctcccgtgcttgcccaagtgcatcaagag
ttagcccaaatttgcccatctaaagttgctgatcctagaccaggacctgcaattccttct
ctagaaggaaaagagggtagcaattcttatcagcatttgcatgtgcccgtgcgcataatg
gatgatttcctaaggctagctcggtcaaacacagaaaggaatttagaaacttgtggagta
cttgctggctctctgaaaaacagggtttttcatatcactactctcataatcccaaagcag
gagtctacctcagattcttgccaaacactaaacgaggaagaaatattcgaagtacaggac
agactctctctatttcccttgggttggattcatacacatcctacacaaacttgcttcatg
tcatcagttgatcttcacacacactactcatatcagataatgctaccggaggcagtggca
atcgtaatggctccaacagacgaatcaacacctcacggaatattccatctctctgaccca
tcaggcgtatcagtgatccgtaactgccagcaacgaggcttccacccacacgaagaatca
gaagacggtaacccaatatacgagcattgctcacacgtcttcctcaatgccaaactcaaa
tacgaagtcctggatctccgctaa

DBGET integrated database retrieval system