KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_493270Help
Entry
ARALYDRAFT_493270 CDS       T01578                                 

Definition
At4g16144
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aly00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ARALYDRAFT_493270
Enzymes [BR:aly01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ARALYDRAFT_493270
Peptidases [BR:aly01002]
 Metallo Peptidases
  Family M67
   ARALYDRAFT_493270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 507 aa AA seqDB search
MKIDLNKVARKIEVDNRIPLRNYYRIADNLLRQASIYREEKNVVDLYIMLLRYSSLISET
IPFHRDYQASLPQERLGSRKRLRAVINELESLKPEFNRLVDKLNRVEDESRLVGSDLPIV
SYSSDAVEWPPAHKASYSGPDINKPLPTSQPSWTYNNNLTSSSNRTQIDQQFQKLSFDFL
PPNQATLSRHSFLGPNGLKSQWVAPKSEIKVQYPSNTDWGSADNSGLIEAGPSGSSASHN
GDSQEVSTLNSVLSLDDGRWQQHSEAVNSQFISDATEDPFQFVGMKQPSPPPVLAQVHQE
LAQICPSKVADPRPGPAIPSLEGKEGSNSYQHLHVPVRIMDDFLRLARSNTERNLETCGV
LAGSLKNRVFHITTLIIPKQESTSDSCQTLNEEEIFEVQDRLSLFPLGWIHTHPTQTCFM
SSVDLHTHYSYQIMLPEAVAIVMAPTDESTPHGIFHLSDPSGVSVIRNCQQRGFHPHEES
EDGNPIYEHCSHVFLNAKLKYEVLDLR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgatctgaacaaggtggctcgtaaaatcgaagtcgataatcgtatccctctt
cgtaattactaccgtatcgccgataatctcctccgacaggccagtatatatcgggaagag
aagaatgtggtggatttgtatatcatgcttcttagatattcaagtttgatttctgaaaca
attcctttccatcgagattaccaggcatcgcttccacaagaaagacttgggagtaggaag
aggttgcgtgctgtaatcaatgagctcgagtctctgaaaccggaattcaaccggctagtt
gataagctgaacagagttgaggatgaatcccgtctggttggaagtgatctcccgattgtt
tcatatagttcagatgctgttgagtggcctcctgctcataaagcttcatactccggacct
gatattaacaagcccttaccaacatctcaaccatcctggacgtataacaataatctgaca
tcatcttcaaatcgtacacagatcgatcagcaattccagaagctatcttttgattttctg
cctccaaaccaagcaaccttgtcaaggcattcatttctaggtccgaatggtcttaaaagt
caatgggttgcacccaagtcggagataaaggttcaatatccgagtaatacggattggggt
tctgcagacaattctggtttaattgaagctggaccaagcggttcctcagcatcacataat
ggtgattctcaagaagtctcaacgctgaactctgtgctctccttagatgatggtcgatgg
cagcaacattctgaggcagtaaattcccagtttattagtgatgcaactgaagacccgttt
cagtttgtcggtatgaagcaaccttcccctcctcccgtgcttgcccaagtgcatcaagag
ttagcccaaatttgcccatctaaagttgctgatcctagaccaggacctgcaattccttct
ctagaaggaaaagagggtagcaattcttatcagcatttgcatgtgcccgtgcgcataatg
gatgatttcctaaggctagctcggtcaaacacagaaaggaatttagaaacttgtggagta
cttgctggctctctgaaaaacagggtttttcatatcactactctcataatcccaaagcag
gagtctacctcagattcttgccaaacactaaacgaggaagaaatattcgaagtacaggac
agactctctctatttcccttgggttggattcatacacatcctacacaaacttgcttcatg
tcatcagttgatcttcacacacactactcatatcagataatgctaccggaggcagtggca
atcgtaatggctccaacagacgaatcaacacctcacggaatattccatctctctgaccca
tcaggcgtatcagtgatccgtaactgccagcaacgaggcttccacccacacgaagaatca
gaagacggtaacccaatatacgagcattgctcacacgtcttcctcaatgccaaactcaaa
tacgaagtcctggatctccgctaa

DBGET integrated database retrieval system