KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_493429Help
Entry
ARALYDRAFT_493429 CDS       T01578                                 

Definition
(RefSeq) ATARD1
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00270  Cysteine and methionine metabolism
aly01100  Metabolic pathways
Module
aly_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ARALYDRAFT_493429
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     ARALYDRAFT_493429
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     ARALYDRAFT_493429
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding Cupin_1 DegQ
Motif
Other DBs
NCBI-GeneID: 9304330
NCBI-ProteinID: XP_002868258
UniProt: D7MGX2
Position
Unknown
AA seq 192 aa AA seqDB search
MGEAVKDGREEVIEAWYMDDSEEDQRLPHHKDPKEFVSLDKLAELGVLSWRLDADNYETD
EDLKKIRESRGYSYMDFCEVCPEKLPNYEVKVKSFFEEHLHTDEEIRYCVAGSGYFDVRD
RNEAWIRVWVKKGGMIVLPAGIYHRFTVDSDNYIKAMRLFVGEPVWTPYNRPHDHLPARK
EYIDNFMINASA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagcggtcaaggatggaagagaagaagtgattgaggcttggtatatggatgat
agtgaagaggatcagagacttcctcaccacaaggatcctaaagagtttgtatctttggac
aaacttgcagagctgggagtacttagctggagacttgatgctgataactatgaaaccgat
gaggatttgaaaaagatccgcgaatctcgtggttactcttacatggacttttgtgaggta
tgcccggaaaagcttccaaactatgaagtgaaagtaaagagctttttcgaagaacatttg
cacactgatgaagagatccgttactgcgttgcaggaagcggttactttgatgtgagggat
cgcaatgaagcttggattagagtatgggtaaagaagggaggtatgatagtcttacctgct
ggaatatatcaccgcttcactgtggactcagacaactatatcaaggcaatgcggcttttc
gtgggtgaaccggtgtggacaccatacaatcggccacacgaccatcttcctgcaaggaaa
gaatatatcgataacttcatgatcaacgcctccgcttag

DBGET integrated database retrieval system