KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_494122Help
Entry
ARALYDRAFT_494122 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ARALYDRAFT_494122
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_494122
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARALYDRAFT_494122
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ARALYDRAFT_494122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 507 aa AA seqDB search
MVSQLLLPPNHFTKSVSAKVFFTGDYQGFSDLTLRRKSNQAQRVSNNGFSLRAKADLRFT
NNKSLVEIPKQWYNLVADLSVKPPPPLHPKTFQPIKPEDLSHLFPNELIKQEATQKRFID
IPEEVLEIYKLWRPTPLIRAKRLEKLLQTPARIYFKYEGGSPAGSHKPNTAVPQAYYNAK
EGVKNVVTETGAGQWGSSLAFASSLFGLDCEVWQVANSYHTKPYRRLMMQTWGAKVHPSP
SDLTEAGRRILESDPSSPGSLGIAISEAVEVAARNEDTKYCLGSVLNHVLLHQTIIGEEC
IQQMENFGETPDLIIGCTGGGSNFAGLSFPFIREKLKGNINPVIRAVEPSACPSLTKGVY
AYDFGDTAGLTPLMKMHTLGHDFIPDPIHAGGLRYHGMAPLISHVYEQGFMEAISIPQIE
CFQGAIQFARTEGIIPAPEPTHAIAATIREALRCRETGEAKVILMAMCGHGHFDLASYDK
YLKGELIDLSFSEEKIRESLSKVPHVV
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtctctcaattgcttttgcctccaaaccatttcaccaaatcagtctcagctaaagtt
ttcttcactggtgattatcaaggatttagtgacttaaccctgagaagaaaatctaatcaa
gcacaaagggtttcaaataatggatttagcttaagagcaaaagcagatttgagatttact
aacaacaaatcattggttgaaattccaaaacaatggtacaatcttgttgctgatctttca
gtcaagccacctccaccgttgcatccaaagactttccaaccgataaaacccgaagatttg
tctcatcttttccccaatgagttgattaaacaagaagcaacacaaaagaggtttattgat
atccctgaggaagttcttgaaatctacaagctttggcgtccaactcctctaatcagagca
aagagattagagaagcttcttcaaacaccggcaaggatttacttcaagtatgaaggtggt
agcccagctggttcacacaaacccaacacagcggttccgcaagcttattacaatgcgaaa
gaaggtgtcaagaacgttgtgacggaaaccggcgctggccaatggggcagttctttagcc
tttgcttctagtctatttggccttgattgtgaagtatggcaagtagccaactcgtaccat
acaaagccatatcgtcggttaatgatgcaaacttggggtgcaaaggttcatccatcgcca
tcggatctcactgaggcaggtagaagaatcctcgaatccgatccatcaagtccgggaagt
ttaggcattgcgatttcagaagctgttgaagttgcagcgagaaacgaggatacaaaatac
tgcctagggagtgtattgaaccatgtgttgttacatcagacaattattggagaagaatgc
attcaacaaatggagaattttggcgaaacacctgatttgatcatagggtgtactggtgga
ggatcaaattttgctggtttgagttttccttttattcgagagaaactcaaaggaaatata
aaccctgttataagagcggttgagccctccgcttgtccttccttgaccaaaggggtttac
gcgtatgattttggcgatacagctggattgactcctttgatgaagatgcatactttagga
catgacttcattcctgatcctatccatgccggtggattacggtaccatgggatggcaccc
ttgatctcacatgtttatgaacaaggattcatggaagcaatttcaattcctcaaatcgag
tgtttccaaggtgctattcagtttgcaagaacagaagggataatacccgcaccagaaccg
actcacgccattgctgcaaccataagagaagctctccgatgcagagagacaggagaagca
aaagtgatactaatggctatgtgtggacatggccacttcgaccttgcctcttacgacaag
tatttaaaaggcgagttgatagatttatcattcagcgaagagaagatacgagagtctttg
tccaaggttcctcatgttgtttaa

DBGET integrated database retrieval system