KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_494249Help
Entry
ARALYDRAFT_494249 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00062  Fatty acid elongation
aly01100  Metabolic pathways
aly01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    ARALYDRAFT_494249
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     ARALYDRAFT_494249
Lipid biosynthesis proteins [BR:aly01004]
 Fatty acid synthase
  Component type
   ARALYDRAFT_494249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF676 Lipase_2
Motif
Other DBs
NCBI-GeneID: 9301200
NCBI-ProteinID: XP_002865126
UniProt: D7MPU9
Position
Unknown
AA seq 314 aa AA seqDB search
MGNKGLKRSCVVVAVALLAMVHVSVSVPFIMLHGISAQCSNARDANFTQLLTNLSGSPGF
CLEIGNGVGDSWLMPLARQAEIACEKVKQMKELSQGYNIVGRSQGNLVARGLIEFCDGGP
PVYNYISLAGPHAGISSVPMCGSGLFCKLADELIKGDIYSDFIQDHLAPSGYLKIPTDMT
KYLENSKYLPKLNNEIPNQRNSTYKDRFTSLQNLVLIKFQDDKVIVPKDSSWFGFYPDGE
FEPLLSAQQTKLYTEDWIGLKTLDDAGKVKFVSVAGEHIRMADEDVVKHVVPYLQDQPSS
VQRVNRKTKQPLHP
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgggaaataaaggtttgaagcggtcttgtgttgtggtggcggttgcattattagccatg
gttcatgtttctgtttcagttccgttcataatgcttcatggaatctcagctcaatgttct
aatgctagagatgctaacttcacacagcttctcactaacctctctggctctcctggcttt
tgcttagaaattggaaatggagtaggcgattcatggttaatgccacttgcacggcaagcg
gaaatagcttgtgagaaggtgaagcaaatgaaagagttgagtcaaggatacaacattgtt
ggaagatctcaggggaacctagtggctcgaggcttaattgagttctgcgacggtggccct
ccggtttacaactatatatccttggctggtcctcatgctgggatatcctctgttcctatg
tgtggttctggtttattctgtaagttagcagatgagctaatcaagggagatatctatagc
gacttcattcaagatcatcttgctcctagtggttatctcaaaattcctactgatatgaca
aagtacttggaaaactctaagtatctacctaagcttaacaatgagataccaaatcaaaga
aactcaacttacaaagaccgtttcaccagtttacaaaacctggttcttatcaagtttcag
gacgataaggttattgttccaaaagattcatcgtggttcgggttttatccggatggtgaa
tttgaacctcttctctctgctcaacagacaaagctctatacagaggattggataggtctg
aaaacattggatgatgctggaaaagtgaagtttgtgagtgtagccggtgaacatatcaga
atggcagatgaagatgtcgtcaaacatgttgtaccttatctccaggaccaaccgtcttcg
gtgcaaagagtcaaccgcaagacgaagcagcccttgcatccttag

DBGET integrated database retrieval system