KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_494386Help
Entry
ARALYDRAFT_494386 CDS       T01578                                 

Definition
Mg chelatase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARALYDRAFT_494386
Enzymes [BR:aly01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ARALYDRAFT_494386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 418 aa AA seqDB search
MASLLGASPSSIFTCPRLSSPSSTSSISLVCFGPGKICGRIQFNPKKNKSRYHVSVMNVA
TEINYVEQGKKFDSKESARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKS
TTVRSLVDLLPEIMVVAGDPYNSDPRDPECMGKEVREKVQKGEQLPVIETKINMVDLPLG
ATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGW
NTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIVEERA
RFDSNPKEFRESYQAEQLKLQEQITTARSNLSAVQIDQDLKVKISKVCAELDVDGLRGDM
VINRAARALAALQGRDQVTAEDVGIVIPNCLRHRLRKDPLESMDSGILVTEKFYKVFS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcttctcggagcatctccttcttcaatcttcacttgccctcgtctttcttct
ccttcctcaacatcttctatctcccttgtctgcttcggaccagggaaaatttgtggaaga
atccaattcaatccaaagaagaacaaatctcgttaccatgtttcggttatgaatgtcgct
acagagatcaactatgttgaacaaggaaagaagtttgattcaaaggaaagtgcgaggccg
gtttatccgtttgctgctattgttggacaagatgagatgaagctatgccttttgttaaat
gtgattgacccgaagattggcggtgtgatgataatgggagatagaggaactggtaaatca
acaactgttagatctttagttgatttgcttcctgagatcatggttgttgctggtgatccg
tataactcagacccgagagatcctgagtgtatgggaaaggaagtaagagagaaagttcaa
aagggagaacaattgccggttattgaaaccaaaatcaatatggttgatcttcctttaggt
gctacggaagatagagtttgcggaactattgatatagaaaaagcgttaacggaaggtgtt
aaggcgtttgagcctggactactagctaaagccaatagagggattctttatgttgatgaa
gttaatctcttggatgatcatttagttgatgttcttcttgattcagctgcatcgggttgg
aacactgttgaaagagaagggatatcgatttctcaccctgctcggtttatcctaattggt
tcaggaaatcctgaagagggagagcttagaccacagcttcttgacaggtttggtatgcac
gcgcaagtagggacagttagagacgctgagctaagagtcaagattgttgaagagcgagct
cgtttcgatagtaacccaaaggagtttcgagaatcttatcaagcagaacaactgaagctt
caagagcagattacaactgcaagaagcaatctttctgcagttcagattgatcaagatttg
aaagtgaagatctctaaggtctgtgctgagctggacgttgacggactgagaggagacatg
gtgataaacagagcggctagagcacttgcggcactccaaggaagagatcaagttacagct
gaagatgttggtattgttataccgaactgcttacgacacagactcagaaaagatccattg
gagtctatggattcgggaattctcgttaccgagaagttctacaaggttttcagttag

DBGET integrated database retrieval system