KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_494741Help
Entry
ARALYDRAFT_494741 CDS       T01578                                 

Definition
dihydroflavonol reductase
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    ARALYDRAFT_494741
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     ARALYDRAFT_494741
    1.1.1.234  flavanone 4-reductase
     ARALYDRAFT_494741
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 384 aa AA seqDB search
MVSQTETVCVTGASGFIGSWLVMRLLERGYFVRATVRDPGNLKKVQHLLDLPNAKTQLTL
WKADLSEEGSYDDAITGCDGVFHVATPMDFESKDPENEVIKPTVNGMLGIMKACVKAKTV
RRFIFTSSAGTVNVEEHQKSVYDENDWSDLEFIMSKKMTGWMYFVSKTLAEKAAWDYAEE
KGLDFVSIIPTLVVGPFITTSMPPSLITALSPITRNEAHYSIIRQGQYVHLDDLCNSHIF
LYEQEAAKGRYICSSHDATILTISKFLRQKYSEYNVPSTFEGVDENLKSIEFSSKKLTDM
GFNFKYSLEEMLIESIETCRQKGFLSVSLPYQSISENKGPTKDDNIELKAGDGLTDGMMP
CNKIEPGLTGERTDAPMPAEQMCA
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcagacagagaccgtgtgtgtaacgggcgcttcgggattcatcggttcatgg
ctagtgatgcgattactcgaacgtggttactttgttcgtgccactgtgcgcgatcctggg
aatttgaagaaagtgcaacatcttcttgatttgccaaatgccaagacgcaactcacttta
tggaaggctgatttatctgaggaaggaagctacgatgacgccataaccggatgtgacggt
gttttccacgtggcaactcccatggattttgaatcaaaagatcctgagaacgaagtgata
aaaccgacagtgaatggaatgttggggattatgaaagcatgtgttaaggcaaagactgta
cgaagattcatatttacttcatctgctggaactgttaatgtagaagaacatcagaagagt
gtctacgatgaaaacgattggagcgatcttgagtttatcatgtccaaaaagatgacagga
tggatgtattttgtgtcgaaaacattagccgagaaagcagcgtgggattacgccgaggaa
aaaggattagatttcgttagtattattccaacattggtggtcggtccatttataacaaca
tctatgccgcctagcctcatcaccgcgctctctcctatcactcggaacgaggcacattac
tcgattataagacaaggacagtatgtgcatttggacgacttatgcaactctcatatcttc
ttatacgaacaagaagctgccaaaggacgttatatttgttcctctcacgatgctacaatt
cttactatctcaaaatttctcaggcaaaaatactccgaatacaacgtgccttcaacgttt
gaaggtgtggatgagaatctaaagagcattgagttcagttccaagaagctgactgacatg
gggtttaacttcaagtatagtctcgaggaaatgttaattgagtctattgagacatgtcgt
caaaagggttttctctcggtttctttaccgtaccaatccatatcggagaacaaaggtccg
acgaaggatgacaatattgagctcaaagccggagatggtttaaccgatggtatgatgcca
tgtaacaagatagaaccggggctaaccggcgagagaaccgatgctcccatgccagcagaa
cagatgtgtgcttag

DBGET integrated database retrieval system