KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_494873Help
Entry
ARALYDRAFT_494873 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ARALYDRAFT_494873
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ARALYDRAFT_494873
Enzymes [BR:aly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ARALYDRAFT_494873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 375 aa AA seqDB search
MRSLQHFPSSAIQRRLSQFNIHDKLTRPSSCLPLRAQKSGITEGSGKVSDLKISEQEVGM
YQNEVVESQGIRIRRRPPTGPPLHYVGPFEFRLQNEGNTPRNILEEIVWHKDKEVAQMKE
RKPLYTLKKALDNVPPAKDFIGALRSAHQRTGLPGLIAEVKKASPSRGILREDFNPVEIA
QAYEKGGAACLSVLTDDKYFKGSYENLQAIREAGVKCPLLLKEFIVEAWQIYYGRSKGAD
AVLLIASVLPDLDIKYMIKICKILKMATLVEVHDEREMDRVLAIEGVELIGINNRNLETF
EVDLGITKKLLEGERGELIRQKDILVVGESGLFTPEDIAFVQEAGVKAVLVGESLIKQSD
PGKAISSLFGRDISE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctcttcagcactttccctcctccgccattcaacgacggctctctcagtttaac
atccacgataaacttaccagaccctcttcttgtcttcctcttcgtgctcaaaagtctgga
atcactgaaggttccggtaaagtaagtgatctcaagattagtgaacaagaagtggggatg
taccagaatgaagtagttgagagtcagggtattaggataaggagaagaccacctactgga
cctccattgcattacgttggaccttttgagttccgcctccagaacgagggtaacacgcct
cgtaatatcttggaagagatcgtatggcacaaggataaagaagttgctcagatgaaagag
aggaagcctctttataccttgaagaaggctcttgataatgttcctcctgctaaagacttc
attggtgctcttagatcagctcatcaaagaacggggttgcctggtttaatagctgaggtt
aagaaagcttctccaagcagaggaatccttagagaggattttaaccctgttgaaattgca
caagcttatgagaagggtggagcagcatgtcttagtgttttgacagatgacaaatacttc
aagggaagctatgagaacctgcaagctataagggaagctggtgtaaagtgccctttgcta
ttgaaagagttcattgtagaggcatggcagatatactatggtagaagtaaaggcgccgat
gcagttttgttgatcgcttctgtgttacctgaccttgacatcaaatacatgattaagatt
tgcaaaatacttaaaatggctacacttgtggaggttcatgacgaaagggagatggatcgt
gttcttgcaattgaaggagtcgagctcattggcatcaataaccgtaaccttgaaacattt
gaggtagatcttggtatcacaaagaagctacttgagggagagcgtggcgaattgatccgt
caaaaagacatccttgtggttggagaatctgggttattcactcccgaagatattgccttt
gttcaagaagccggcgtcaaagcagttctagtcggtgaatctcttattaaacaaagtgat
ccggggaaggcaatcagctccctttttggaagagatatctccgagtag

DBGET integrated database retrieval system