KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_495082Help
Entry
ARALYDRAFT_495082 CDS       T01578                                 

Gene name
PIMT2
Definition
protein-L-isoaspartate methyltransferase 2
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 274 aa AA seqDB search
MRAQVLLFPTITAYGRLYCAPRRLHRYNSSSSSQFLNLSLSRFSGGLFFHMESGTSSSGK
KSMVENLKRYGVISSKRVAQVMEALDRGLFVPVGSSAYVDTPVPIGYNATISAPHMHATC
LQLLEDKLQPGMCALDVGSGTGYLTGCFALMVGAEGRVVGVDHIPELVDMSIKNIEKSVA
ASLLKKGSLSLHVGDGRKGWQEFAPYDAIHVGAAASEIPQPLLDQLKPGGRMVIPLGTYF
QELKVIDKNEDGSIKVHTETSVRYVPLTSRDEQL
NT seq 823 nt NT seq  +upstreamnt  +downstreamnt
atgagagctcaggttttattattcccaacaataacagcctatggtcgcctctattgtgcg
ccacgtagacttcaccgctacaattcatcatcatcatctcagtttctgaatctcagtctc
tctcgcttctccggtggtctcttcttccacatggagagtggaactagctcgagtggcaag
aaatcaatggtggaaaatttgaagcggtatggtgtgatatcatcgaagagagtagctcaa
gttatggaagctttagatagaggtctctttgtaccagttggatcttcagcttatgttgat
actcctgtacctataggttataatgctaccatttctgctccgcatatgcatgccacttgc
ttgcagcttttggaagataagctccagcccgggatgtgtgctttggatgttggttcagga
accgggtacttgactggctgttttgctttgatggttggagctgagggacgcgttgttggt
gtggatcatatccctgaattggttgatatgtctatcaagaatatcgaaaagagtgtcgct
gcttccttgcttaagaaaggatctctctccctacatgttggtgatggaagaaaaggttgg
caagagtttgcaccgtatgatgcaatacacgtaggagcagcggcatcagaaatcccgcag
cctcttttggatcagctaaaacccggtggacgaatggtgatcccactaggaacctatttt
caagagctcaaggtaattgataaaaacgaggatggttccatcaaggtacatactgaaact
tcggtcaggtatgtgcccctcactagccgcgacgaacagttag

DBGET integrated database retrieval system