KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_495190Help
Entry
ARALYDRAFT_495190 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    ARALYDRAFT_495190
Messenger RNA biogenesis [BR:aly03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     ARALYDRAFT_495190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1808 aa AA seqDB search
MVSPKELVAIVHSSLLGTSLPTPTQRIELTHAIRNSFSSIQNLLSFPPPKPSDRAQVQSK
EIRLPDSLPISLDDQDVAISLKLSDELHLNEIDSVRLLVSANQEWGLMGRDPLEIQRLAT
GLWYTGRRDLTSTLYTLLRAVVLDQGLEPDLIADIQGLLEELIKAGLRQRLITLVKELNR
QDPTGLGGPLCERYLIDSRGALVERRAVVQRERLILGHCLVLSILVDRPGSKDVKDIYYV
FKDNAAQLTEGNDTISSQITFSLLFSLIITFVSDAISGLSDKSSMISQDASFRTDFQDIV
MASGSDPTADGFIGGIRLAWAVHLMLIHDGISGMDTISTASTKDMGHICSCLESIFSKNV
FQFLLDNVLRTAAYQVKESKDMAMSVLNSYRTCDSLDGSMQTEEADRPLPFISLMEFKEP
ELLSGNDVLWTFVNFAGEDHTNFKTLVAFLEMLCTLASTQEGASKVYELLRGTSFRSIGW
PTLFDCIRIYDEKFKQSLQTAGAMMPEFLEGDAKALVAYLNVLQKVVENGNPTERKNWFP
DIEPFFKLLGYENIPPYLKGALRKTIAAFVNVFPEMRDSIWAFLEQYDLPVVVGSPVGKS
DQSSQVYDMQFELNEVEARREQYPSTISFLNLINALIAGEKDVNDRGRRAYSDPCEKWQL
VVACLQHFHMILSMYDIQEEDLDGFTEHPHFLVSVETSSLQTQLPIIELLKDFMSGKALY
RNLMGILQVGVNAIISERLSKTYGKILEKAVQLSLEILLLVFEKDLLVSDVWRPLYQPLD
IILSQDHNQIIALLEYVRYDSLPQIQRSSIKIMNILRCSRLVGLVPMLIKIDAANSLIED
YAACLEVRLEEGEVVENSCDDLGVLIMQLLVDNINRPAPSITHLLLKFDLDAPVEGTVLQ
PKFHYSCLKVILEMLEKLPNPDINFLLFEFGFQLLCELNLDPLTSGPTMDLLSSKKYQFF
LQHLDTIGVATLPKRSGSQALRISSLHQRAWLLKLLAIALHTGSGSSSAHLEACQSILSH
LFGREVTEAANEPFSSSTYPQDGLDYTGTSSISKSKALALLEILQFRSPDTSMQLPQIVS
SLKYDSLVEDILENRDNSVSGSIYYYSERGDRLIDLSSFSNKLWQKLHSGFPLVDSFPNV
AELSEVRETIQQLLKWGWKYNRNLEEQAAQLHMLAGWSQIVEVSACRRISSLDNRSEILY
RILDASLSASASPDCSLKMAFVLTQVALTCIAKLRDDRFSFQGALSSDTVTCLDVMMVKH
LSTGACHSVLFKLVMAILRHESSESLRRRQYALLLSYFQYCQHMIALDVPTSVVQFLLLN
EQDGEDLDIQKIDKEQADLARANFFIIKKEAQGILDLVIKDASQGSEFGKTISLYVLEAL
VCIDHERYFLSQLQSRGFIRSCLGSISNISYQDGTHLLESQQRACTLEAEFALLLRISHK
YGKSGGQVLFSMGALEHIASCRAISFKGNMRRVDMKLQSDVGYNVQKQRTIITAVLRLMF
ALTSLVETSEFFEGRNKIVREVIEFIKGHQFLFDQLLREDFTQADDLLMEQIILAVGILS
KVWPFEENDGYGFVQGLFDMMSNLFIVSPIKLISSQVSELKLSQLRFSLTSYLYFLVTKN
SLRLQVSDDSLDSSTKLRQPTLLLLASLLSHVTDSLERAAEKKSLLLHKIRDINELSRQD
VDAIIKICDCQEYVTPSDNIHKRRYIAMVEMCQIVGNRDQLITLLLQLAEHVLNIILIHL
QDRSVSSNERGSYGSKSHLQQDVTDLCGKLSPTIERLALLNEGKVGHNLKVFQRLATTVK
EMAIQKCL
NT seq 5427 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgccgaaagagttagtggccatagtacactcttcactgctcggaacgtcactg
ccaactccaacgcagcgtatcgaactcactcatgccattcgcaactcattttcctctatt
cagaacctcctctctttcccgcctccgaagccgtcggacagagcgcaagttcagtccaaa
gaaattcgactcccggattcgctgccaatatctttggatgaccaagatgtcgctattagc
ttgaaactgagtgatgagcttcacctaaatgagatagattctgttcgtctgcttgtatct
gcaaatcaggagtggggcttaatgggacgggaccctcttgagattcaacggcttgcaact
ggactatggtatacagggagaagagatcttacgtcaactctatacacactcctgagggca
gttgttctggaccaggggcttgaacctgatcttatagctgacattcagggactcttagaa
gaacttattaaagctgggctcagacaacggttgattactcttgtaaaggaactcaatcgg
caggatcctactggattgggtgggcccttatgcgagcgataccttattgactcaagaggt
gctcttgttgaacgaagagctgttgttcagagggaaagactgatactgggacattgcctt
gttctttcaattttggttgatagacctggttcgaaagatgtgaaggatatatactacgtt
tttaaagataatgcagctcaattaactgaaggaaatgacaccataagttctcagattact
tttagtcttttgttttctctcatcatcaccttcgtatcagatgcaatcagtggactatct
gataagtcatctatgatatctcaagatgcttcgtttaggacagactttcaggatattgtt
atggcttctggcagtgaccccactgctgatggcttcattggtggcataaggcttgcctgg
gctgtacatttaatgctgatacatgatggaatatctggaatggatacgatttccactgct
tcaacaaaagatatggggcacatatgctcctgcctggagtccatcttctcaaaaaatgtg
tttcaatttttgctggataatgttcttcgaactgcagcctaccaggtgaaggaatcaaag
gacatggctatgagtgttctaaattcttaccgaacttgtgattcgcttgatggaagtatg
cagactgaagaggctgacaggccgctgcccttcatttctcttatggagtttaaggaacct
gagctactctccgggaatgatgtcttgtggacatttgtgaattttgctggagaggaccac
acaaattttaaaactcttgtggctttcttggaaatgctgtgtaccttggcttccactcag
gaaggtgcttctaaagtttatgagttgctccggggtacatcattccgcagtataggatgg
cccactttgtttgattgtataagaatttacgatgagaagttcaagcagtctcttcaaact
gctggagccatgatgccagagttcctggagggcgatgcaaaagcacttgtcgcatatctg
aatgtacttcagaaggttgttgagaatggtaatcccactgagaggaaaaactggtttcct
gatatcgaaccattttttaagcttcttggttatgaaaacatccctccatatctgaagggt
gctcttagaaagaccattgctgcctttgttaatgtctttccagaaatgagggactctatc
tgggcttttcttgagcagtatgatctgcctgttgttgtgggatcaccagttggaaagagt
gaccaatcttctcaggtctatgatatgcaatttgagttaaatgaagtggaagcaaggaga
gaacagtatccttcaacaatatcgttccttaatcttataaacgctctgattgctggggag
aaagatgtgaatgatcgtgggcgtagggcatattctgatccttgtgagaagtggcaattg
gttgtggcatgccttcaacattttcacatgatcttaagcatgtatgatattcaggaggag
gatctcgatggatttactgagcatccacattttttggtgtcagttgaaacatcttcactg
caaacgcagctaccaattatagaattactaaaagatttcatgagtgggaaagctctctac
aggaacctcatgggtatccttcaggttggggtcaatgccatcatcagcgagcgattgagt
aaaacttatgggaagatcttagaaaaggcagtacaactttctttggaaatcttactgctc
gtctttgagaaggatttgcttgtttccgatgtttggcgtccgctgtaccagcctttggat
ataattctctcacaagatcataatcaaattatagccttgctggagtatgtcagatatgat
tctcttcctcagattcagcgatcttcaatcaaaatcatgaacattttaaggtgttctcgc
ttggttggacttgttccaatgctgatcaaaattgatgctgcgaattccttgatcgaggat
tatgcggcctgccttgaggtacgacttgaagagggtgaagttgtagagaacagttgtgat
gatctgggggtccttattatgcagcttctggttgacaatatcaaccggcctgcaccaagt
atcacacatttgcttctgaagtttgaccttgacgcccctgtggaagggacagttttgcag
cctaagtttcactacagttgtctgaaggtcattcttgaaatgttggagaagcttccaaac
cccgatataaacttcttactctttgagtttggcttccagcttttgtgtgagttgaatttg
gatccgttaactagtggtccaaccatggatctcttgagcagcaagaaatatcagtttttt
ctccagcacctcgataccattggtgttgccactcttccaaaaagaagtggcagccaggca
ctccgtattagttcccttcatcagagggcgtggctattaaagctcctagctattgcactg
catactggttctggaagcagttcagctcacctagaggcatgtcagagcatactttctcat
ctttttgggcgggaggtaactgaagcagcgaatgaacctttttcttccagtacatatcct
caggatggtcttgattatactggaacgagttcaatcagtaaaagtaaggcattggctttg
cttgaaattcttcagtttagatctcctgatacttcgatgcagcttcctcaaattgtgtcc
agcctaaagtatgactcactggtggaggacatacttgagaaccgtgataactctgttagt
ggcagtatctactactattctgagcgtggtgatcggctaattgatctatcttccttcagc
aacaaactctggcagaagctacattctggatttcccctagtggatagttttccaaatgtt
gctgagcttagtgaagttagagagacaattcaacagctgttgaaatggggctggaagtat
aatcgaaaccttgaggagcaagctgcccaacttcatatgttagctggctggtctcagatt
gttgaggtgtctgcttgcaggagaatatcttctcttgataatcggtctgaaattttgtac
cggatacttgatgcctctcttagtgcctccgcgtctccagattgttcattaaaaatggcg
ttcgtacttactcaggttgcccttacctgcattgccaaacttcgtgatgatagattttca
tttcaaggggccttgagttctgacaccgtgacatgtctagatgttatgatggtcaaacat
ttatccactggtgcttgccactcagttctatttaaacttgttatggcaattctaaggcat
gagtcatcagaatctttgagaaggcgccaatatgcattgctcttgagctatttccagtac
tgccagcatatgattgctctggatgtgccaacatcagttgtgcagttcttgttacttaat
gagcaagacggtgaagatttggatatccagaagattgacaaggagcaggctgaccttgct
cgtgccaacttttttataataaagaaagaagctcagggcatcttggatctggtaatcaag
gatgcaagtcaaggcagtgagtttgggaaaacaatatcactttatgtgctggaagctctt
gtttgtattgatcacgagagatattttcttagtcagctccagagccgaggtttcatacgg
tcttgccttggaagcattagtaatatctcctaccaggatggaacacatttgctggagtca
caacagcgagcatgtaccttagaagcagaatttgcattgctacttagaattagtcacaag
tacggaaagtctggaggccaggttctgttctccatgggtgcgctggaacatatcgcttca
tgtagagctatcagctttaagggaaatatgagacgggtggatatgaaacttcagagtgat
gtaggatataatgtgcaaaagcaacgaacaataatcactgctgtcctaagactgatgttt
gctctaacctcattggttgagacctctgaatttttcgaggggaggaataaaattgttcgt
gaagtcattgagtttatcaaaggacatcaatttctttttgaccaacttcttcgggaagac
tttactcaagcagatgatttattgatggagcaaattattcttgcagtgggaatattgagc
aaggtctggccttttgaagagaacgatggatatggatttgttcaagggctttttgatatg
atgagcaaccttttcatcgtctcccccataaaattgatatcatcgcaggtatcagagctc
aaattgtctcagttgcgattcagcttgacttcttacttatattttctggtgaccaaaaac
tctctgaggttgcaggtttccgatgattctcttgatagttccactaaactacgccaacca
acgttactgttgcttgcatctcttctttcgcatgtgactgattccctcgagagagcagca
gagaaaaagtccttacttcttcataagattagagacataaacgagctctcaagacaagat
gtagatgcgatcatcaagatatgtgattgccaagaatatgtcacaccgtccgacaacata
cataaaaggagatacatagctatggttgaaatgtgccaaatcgtgggtaacagggaccag
ttaatcaccttgttactacaacttgccgagcatgtactaaatattatcctgatccatctc
caagatagatccgttagttcaaatgaaaggggatcatatggttcaaaatcccatctacaa
caggatgttacagatctatgtggcaaattgtcacctaccatagagaggcttgcattactg
aatgagggaaaagtaggacataacctgaaggtgttccagagactggcaacgactgtaaaa
gaaatggccatccaaaagtgtttatga

DBGET integrated database retrieval system