KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_495519Help
Entry
ARALYDRAFT_495519 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ARALYDRAFT_495519
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     ARALYDRAFT_495519
Transfer RNA biogenesis [BR:aly03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    ARALYDRAFT_495519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 373 aa AA seqDB search
MVVESLETEIDTAVRVVHLASSLCVKVQEKLHLPNGGHVKSKDDDSPVTVADFGVQAIVS
WVLAEVFGDQNLSIVAEEDTETLSDADSLGLLGAVSNAINDALSEAPKYGLPKPDKPLGS
TEILKAISRCNSVGGPKGRHWVLDPVDGTLGFVRGDQYAVALALIENGKVLLGVLGCPNY
PVKKECLSNGCNQAMKTKSVPGSVSKGCVMYAKRGSGQAWMQPLIVGGIPESATLLKVSS
VDDPVLATVCEPVERANSNHLFTAGLANSMGVRKQPMRVYSMVKYAAIARGDAEVFMKFA
QSSYKEKIWDHAAGVVIVEEAGGVVTDAGGKNLDFSKGVYLEGLDRGIIACSGQVLHEKI
IGAVYASWESSSL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggaatccttagaaacggagattgacacggcggtgcgtgtggttcacctcgct
tcttctctctgtgttaaagttcaagagaagcttcatcttcctaatggtggtcacgttaag
tctaaagacgatgattcccctgtcaccgtcgcagattttggtgttcaagcaattgtgagc
tgggttttagctgaagtttttggtgatcaaaacctttcaattgttgctgaagaagacact
gagactctctcagacgctgattctttaggtcttttaggagctgtgtcgaatgcgattaat
gatgcattgtctgaagctccgaaatacgggcttccgaagccagataaaccattgggatca
actgaaattcttaaggctattagtcgatgtaactccgttggagggcctaaaggaaggcat
tgggtgcttgatcctgttgatggaacattgggatttgttcgcggggatcagtatgctgtt
gctttagctttgatagagaacggtaaagttctgttgggggtactaggatgtcctaattat
ccggttaagaaagaatgcttaagtaacggttgcaaccaagctatgaagacgaaatctgta
ccggggtcagtatcgaaaggatgtgtcatgtatgcaaagcgaggaagtggtcaagcgtgg
atgcaaccgttgattgttggaggaatcccagaatctgcaacacttcttaaggtttcctca
gtcgatgatccggttttagctacggtttgtgagccagtagagagagcaaactcaaaccac
ttgttcactgcaggacttgccaatagcatgggagttagaaagcagccgatgcgagtgtat
agcatggtgaaatatgctgcgattgcacgaggagacgctgaagtgttcatgaagtttgca
cagtcgagttacaaagagaagatatgggatcacgcggctggagttgttattgtggaagaa
gctggtggtgtggtgactgatgcgggcggaaaaaacttagacttctcgaaaggagtttac
ttggaaggtcttgaccgtggaatcatcgcatgttctggtcaagtattacatgaaaaaatt
ataggtgctgtttatgctagttgggaatcttccagtctctga

DBGET integrated database retrieval system