KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_495590Help
Entry
ARALYDRAFT_495590 CDS       T01578                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 subunit
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00020  Citrate cycle (TCA cycle)
aly00310  Lysine degradation
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARALYDRAFT_495590
  Amino acid metabolism
   00310 Lysine degradation
    ARALYDRAFT_495590
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ARALYDRAFT_495590
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N HlyD_D23 GCV_H HlyD_3 QRPTase_N PYNP_C
Motif
Other DBs
NCBI-GeneID: 9300449
NCBI-ProteinID: XP_002864373
UniProt: D7MUZ3
Position
Unknown
AA seq 463 aa AA seqDB search
MMLRALIRRASTRGSSSASGLGKSLQSSRVVASAQFHSVSATETLVPRGNHSRSFHHRSC
PGCPDCSRTVFNGYQGTALQRWARPFSSDSGDVVEAVVPHMGESITDGTLATFLKKPGDR
VEADETIAQIETDKVTIDIASPASGVIQEFLVKEGDTVEPGNKVARISTSADAVSHVAPS
EKTPEKPAPKPSPPAEKPKVESTKVAEKPKAPSPPPPPPKQSAKEPQLPPKDRERRVPMT
RLRKRVATRLKDSQNTFALLTTFNEVDMTNLMKLRSQYKDAFFEKHGVKLGLMSGFIKAA
VSALQYQPVVNAVIDGDDIIYRDYVDISIAVGTSKGLVVPVIRDADKMNFADIEKTINGL
AKKANEGTISIDEMAGGSFTVSNGGVYGSLISTPIINPPQSAILGMHSIVQRPMVVGGSV
VPRPMMYVALTYDHRLIDGREAVYFLRRIKDVVEDPQRLLLDI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgcgtgctcttattaggagagcttccacgagaggctcttcttctgcttcggga
ttgggaaaatctctgcaatcttctcgtgttgtagcgtctgcccaatttcattccgtttca
gctactgagacgttggtacctcgtggaaaccattctcgtagcttccatcaccgttcttgt
ccagggtgtccagactgttcaaggactgttttcaacggttaccaaggcacagccctgcaa
agatgggccaggcccttttcatctgatagtggggatgtcgtggaagctgttgtgccacac
atgggtgaatcaatcaccgatggaaccctagccacctttctgaagaaacctggtgataga
gtagaagctgatgagactattgcacaaattgaaactgacaaggttacaatagatattgct
agcccagcaagtggagtgatccaagagtttctagtcaaggaaggagatactgttgaaccg
ggaaacaaggttgctagaatttctacatctgcggatgctgtgtctcatgttgcaccctca
gaaaagacaccagagaaacctgctcccaagccttctcctcctgctgagaagcccaaagtt
gaaagtactaaagttgcagagaaacccaaggcaccatcaccgccaccgccaccgcccaaa
cagtcagctaaagaaccgcagctccctcctaaggatagggaaagacgggttcctatgaca
agacttcgcaaacgggtggcaactaggctgaaagactctcaaaacacttttgctttgctg
acaactttcaatgaagttgatatgactaatctgatgaagctccgatctcagtacaaggat
gctttttttgaaaagcacggagtgaagttggggcttatgtctggtttcattaaagctgct
gttagtgccctccagtaccaaccagtagtaaatgcagttatcgacggggacgatatcatt
tacagagactacgtggatatcagtatcgctgttggtacctctaagggtcttgtggttcca
gtcataagagatgctgacaaaatgaactttgctgacatagagaaaacaataaacggtctt
gctaagaaggctaatgaaggaaccatatcaatcgacgagatggcaggaggatcattcaca
gtatcaaatggtggtgtctatggaagtcttataagcactcctatcatcaaccctcctcag
tctgctattcttggaatgcattcgattgtgcaacgtccaatggttgtgggaggaagcgta
gtaccgaggccaatgatgtatgtcgcactgacttacgatcataggctaattgatggaaga
gaggctgtgtatttcctgcgccgtatcaaggatgttgtggaagatcctcagaggcttctt
ctcgacatatga

DBGET integrated database retrieval system