KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_495661Help
Entry
ARALYDRAFT_495661 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     ARALYDRAFT_495661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 473 aa AA seqDB search
MSLGYAEKLSFIEDVGQVGMAEFFDPSHVLQCKIEELAKLIQKSKHLVVFTGAGISTSCG
IPDFRGPKGIWTLQREGKDLPKASLPFHRAMPSMTHMALVELERAGILKFVISQNVDGLH
LRSGIPREKLSELHGDSFMEMCPSCGAEYLRDFEVETIGLKETSRRCSVEKCGAKLKDTV
LDWEDALPPKEIDPAEKHCKMADLVLCLGTSLQITPACNLPLKCLRGGGKIVIVNLQKTP
KDKKANVVIHGLVDKVVAGVMESLNMKIPPYVRIDLFQIILTQSLSGDQRFINWTLRVAS
VHGLTSQLPFIESIEVSFSDNQNYKDAVLDKQPFLMKRRTARNETFDIFFKVNYSDGCDC
VSTQLSLPFEFKVSTEEHEEIIDKEAVLQSLREKAVEESSCGQSGVVERRAVSEPRSEAV
VYATVTSLRTYHCQQSLLANGYLKWKLEGSGTSRKRSRTGKRKSKAQEEESKA
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaggttacgctgagaaattatccttcattgaagatgttggtcaggtcggcatg
gccgaattcttcgacccatctcatgttctacaatgcaagattgaagaacttgctaagttg
attcaaaagagtaagcatctagtagtctttactggtgcaggcatttcaacttcttgtggt
attcctgatttccgaggccccaaaggaatttggacgctacagcgcgagggcaaagattta
cccaaagcatctctgccatttcatcgtgcaatgccgagcatgactcatatggctttggtt
gaattagaaagagctggcattttaaaatttgttatcagtcagaatgtggatggcttacat
cttcgatctggaataccaagagagaagctttcggaactgcatggagactcttttatggag
atgtgcccatcatgtggagcagagtacctgcgtgatttcgaggtggaaactattggatta
aaggagacatcaagaaggtgttctgttgaaaagtgtggagctaaacttaaagatacggtc
ctagactgggaggatgctttgcctccgaaagagattgatccagcagagaagcactgcaaa
atggctgatcttgtactttgtttgggtaccagtttgcagataacccctgcttgcaatttg
cctctcaagtgtctcagaggtggaggcaagatcgtgatagtcaatcttcagaaaaccccg
aaggacaagaaagcaaatgttgtaattcatggtcttgttgataaggtggttgcaggggtc
atggaatctctcaacatgaagattcctccatatgttagaatcgatcttttccagataatc
ctaactcaatccttaagcggagatcagaggtttattaattggaccctgcgtgttgcaagt
gttcatggattgacttctcagttaccattcatcgagtctatcgaggtttctttctcagat
aaccagaattacaaagacgcagttcttgataagcagccttttcttatgaaaaggagaaca
gcacgaaacgaaacttttgatatattcttcaaagttaattacagtgacggttgtgactgt
gtctccactcaacttagcctcccatttgaattcaaggtttcaacagaagagcatgaagag
ataattgacaaggaggctgtgctacaaagcctgagagagaaagcggttgaagaatccagt
tgcgggcaaagcggtgtggttgagagaagagcggtttctgaaccgagaagtgaggctgtt
gtgtatgctactgtgaccagtctcaggacttaccattgtcaacaatctctgcttgctaat
ggatacctcaaatggaagctggaaggttctggaacgtcccgtaaacgttctagaaccggc
aaacgaaaatcaaaggcacaggaagaagaatcgaaggcatag

DBGET integrated database retrieval system