KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_496324Help
Entry
ARALYDRAFT_496324 CDS       T01578                                 

Definition
(RefSeq) phosphofructokinase family protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00030  Pentose phosphate pathway
aly00051  Fructose and mannose metabolism
aly00052  Galactose metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
aly01230  Biosynthesis of amino acids
aly03018  RNA degradation
Module
aly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_496324
   00030 Pentose phosphate pathway
    ARALYDRAFT_496324
   00051 Fructose and mannose metabolism
    ARALYDRAFT_496324
   00052 Galactose metabolism
    ARALYDRAFT_496324
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ARALYDRAFT_496324
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ARALYDRAFT_496324
Protein phosphatases and associated proteins [BR:aly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ARALYDRAFT_496324
Messenger RNA biogenesis [BR:aly03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ARALYDRAFT_496324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-GeneID: 9302518
NCBI-ProteinID: XP_002864742
UniProt: D7MV38
Position
Unknown
AA seq 530 aa AA seqDB search
MEASISLLGSTKPSLSSLIPSSNVLHRRDFPLPALKLKKVSVLPRILQQKRLIRAQCSDG
FKPEEDDGFVLEDVPHLTKFLPDLPSYPNPLKESQAYAIVKRTFVSSEDVVAQNIVVQKG
SKRGVHFRRAGPRERVYFRSDEVKACIVTCGGLCPGINTVIREIVCGLNNMYGVNNILGI
QGGYRGFYSKNTMTLTPKVVNDIHKRGGTFLQTSRGGHDTVKIVDNIQDRGINQVYIIGG
DGTQKGAEKIYQEVERRGLQVAVSGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVE
VESVENGVGIVKLMGRYSGFIAMIATLANRDVDCCLIPESPFFLEGKGGLFEFIEQRLKE
NRHMVIVIAEGAGQDYVSQSMHVSGTKDASGNRLLLDVGLWLTQQIKDHFTNVRKMMINM
KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYSGFTVGPVNSRHAYIPISRVTEM
TNTVKLTDRMWARLLASTNQPSFLTGEGALQNVIDMETQEKIDNMKISSI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaagcttcgatttcgttacttgggtcaacaaaacccagtctttcctcacttatccct
tcttccaacgtccttcatcgtcgagacttccctcttcctgctttgaaattgaagaaagtt
tcagtgttgcctcgaatcttgcaacagaaacgactcatcagagctcagtgctctgatgga
ttcaaaccagaggaagacgatgggtttgtgctagaagacgtccctcacttgaccaaattt
ctccccgatttaccgtcgtatccaaatccattgaaagaaagccaagcatatgccattgtt
aagcgaacctttgtcagttccgaagatgtggttgcacaaaatattgtagtccagaaggga
agtaagcgaggagtacactttaggcgagcagggcctcgagaaagggtgtacttcagatca
gatgaagtaaaagcttgcatagtcacttgcgggggcttgtgcccaggaatcaatactgtt
atacgggaaattgtatgtggattgaacaatatgtatggtgtcaataacattcttggtatt
cagggaggatatagaggcttttactccaaaaacactatgaccctgactcctaaagtagtt
aatgatattcataaacgcggtggcacgtttcttcaaacctcaagaggaggacatgataca
gtgaagattgttgataacattcaagatagaggaataaaccaggtgtatattattggaggt
gatgggacgcaaaagggtgcagagaaaatataccaggaagttgagaggcgtggtcttcaa
gtggcggtttctggcattcccaagacaattgataatgatattgctgtgattgacaaatca
tttggctttgataccgcggttgaggaagcacaacgagctattaatgctgcacatgtagag
gtcgagagcgtggaaaatggagttggtatcgttaaactcatgggcagatacagtggtttt
attgccatgattgcaactttagcgaaccgtgatgtggattgttgcttgattccagagtct
ccattttttcttgaaggaaagggtgggctctttgagtttattgaacaacgactcaaagag
aacaggcacatggttattgtgatagccgaaggagctggacaggattatgtttctcaaagc
atgcatgtatctggaaccaaagacgcctcaggaaatagactcttgcttgatgttggtcta
tggttgactcaacagataaaggatcactttacaaatgttcggaaaatgatgataaatatg
aagtacatagacccaacgtatatgataagagcaataccgagtaacgcatcagacaatgtc
tattgcactcttcttgcccaaagtgcagttcatggagcaatggctgggtattcaggtttc
actgtaggaccagttaatagcagacatgcttacatcccaatttctcgcgtgactgaaatg
acaaatacggtgaagttaactgataggatgtgggctagactccttgcatcgacaaatcaa
ccgagtttcttgactggtgaaggagcattgcagaatgtgatcgacatggaaactcaagaa
aagatcgataacatgaagatctcttctatctaa

DBGET integrated database retrieval system