KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_496324Help
Entry
ARALYDRAFT_496324 CDS       T01578                                 

Definition
phosphofructokinase family protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_496324
   01230 Biosynthesis of amino acids
    ARALYDRAFT_496324
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_496324
   00030 Pentose phosphate pathway
    ARALYDRAFT_496324
   00051 Fructose and mannose metabolism
    ARALYDRAFT_496324
   00052 Galactose metabolism
    ARALYDRAFT_496324
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ARALYDRAFT_496324
Protein phosphatases and associated proteins [BR:aly01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ARALYDRAFT_496324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 530 aa AA seqDB search
MEASISLLGSTKPSLSSLIPSSNVLHRRDFPLPALKLKKVSVLPRILQQKRLIRAQCSDG
FKPEEDDGFVLEDVPHLTKFLPDLPSYPNPLKESQAYAIVKRTFVSSEDVVAQNIVVQKG
SKRGVHFRRAGPRERVYFRSDEVKACIVTCGGLCPGINTVIREIVCGLNNMYGVNNILGI
QGGYRGFYSKNTMTLTPKVVNDIHKRGGTFLQTSRGGHDTVKIVDNIQDRGINQVYIIGG
DGTQKGAEKIYQEVERRGLQVAVSGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVE
VESVENGVGIVKLMGRYSGFIAMIATLANRDVDCCLIPESPFFLEGKGGLFEFIEQRLKE
NRHMVIVIAEGAGQDYVSQSMHVSGTKDASGNRLLLDVGLWLTQQIKDHFTNVRKMMINM
KYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYSGFTVGPVNSRHAYIPISRVTEM
TNTVKLTDRMWARLLASTNQPSFLTGEGALQNVIDMETQEKIDNMKISSI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaagcttcgatttcgttacttgggtcaacaaaacccagtctttcctcacttatccct
tcttccaacgtccttcatcgtcgagacttccctcttcctgctttgaaattgaagaaagtt
tcagtgttgcctcgaatcttgcaacagaaacgactcatcagagctcagtgctctgatgga
ttcaaaccagaggaagacgatgggtttgtgctagaagacgtccctcacttgaccaaattt
ctccccgatttaccgtcgtatccaaatccattgaaagaaagccaagcatatgccattgtt
aagcgaacctttgtcagttccgaagatgtggttgcacaaaatattgtagtccagaaggga
agtaagcgaggagtacactttaggcgagcagggcctcgagaaagggtgtacttcagatca
gatgaagtaaaagcttgcatagtcacttgcgggggcttgtgcccaggaatcaatactgtt
atacgggaaattgtatgtggattgaacaatatgtatggtgtcaataacattcttggtatt
cagggaggatatagaggcttttactccaaaaacactatgaccctgactcctaaagtagtt
aatgatattcataaacgcggtggcacgtttcttcaaacctcaagaggaggacatgataca
gtgaagattgttgataacattcaagatagaggaataaaccaggtgtatattattggaggt
gatgggacgcaaaagggtgcagagaaaatataccaggaagttgagaggcgtggtcttcaa
gtggcggtttctggcattcccaagacaattgataatgatattgctgtgattgacaaatca
tttggctttgataccgcggttgaggaagcacaacgagctattaatgctgcacatgtagag
gtcgagagcgtggaaaatggagttggtatcgttaaactcatgggcagatacagtggtttt
attgccatgattgcaactttagcgaaccgtgatgtggattgttgcttgattccagagtct
ccattttttcttgaaggaaagggtgggctctttgagtttattgaacaacgactcaaagag
aacaggcacatggttattgtgatagccgaaggagctggacaggattatgtttctcaaagc
atgcatgtatctggaaccaaagacgcctcaggaaatagactcttgcttgatgttggtcta
tggttgactcaacagataaaggatcactttacaaatgttcggaaaatgatgataaatatg
aagtacatagacccaacgtatatgataagagcaataccgagtaacgcatcagacaatgtc
tattgcactcttcttgcccaaagtgcagttcatggagcaatggctgggtattcaggtttc
actgtaggaccagttaatagcagacatgcttacatcccaatttctcgcgtgactgaaatg
acaaatacggtgaagttaactgataggatgtgggctagactccttgcatcgacaaatcaa
ccgagtttcttgactggtgaaggagcattgcagaatgtgatcgacatggaaactcaagaa
aagatcgataacatgaagatctcttctatctaa

DBGET integrated database retrieval system