KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_496673Help
Entry
ARALYDRAFT_496673 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 445 aa AA seqDB search
MGSSANTETAIIIASPASNNQNPATNGGDANQNHTPDGILALTNSESDASKKRRMGVLPL
EVGTRVMCQWRDGKYHPVKVIERRKNYNGCHNDYEYYVHYTEFNRRLDEWIKLEQLDLDS
VECALDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIATIELG
KYEIETWYFSPFPPEYNDCVKLFFCEFCLSFMKRKEQLQRHMRKCDLKHPPGDEIYRSST
LSMFEVDGKKNKVYAQNLCYLAKLFLDHKTLYYDVDLFLFYILCECDDRGCHMVGYFSKE
KHSEEAYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLVSYRGYW
TRILLDILKKHKGNISIKELSDMTAIKAEDILSTLQSLELIQYRKGQHVICADPKVLDRH
LKAAGRGGLDVDVSKMIWTPYKEQS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgggatcgtctgcgaatacagagacggcgattatcatcgcctcaccggcgtcgaacaac
cagaatccggcaaccaacggcggagatgcgaatcagaatcatactcctgatgggatactc
gctctcacgaactcagaatcggatgcgtcgaagaagaggagaatgggggtgcttcctctt
gaggttggtactcgcgtgatgtgtcaatggagagacggaaaataccatccggtgaaggtt
atcgagcgccggaagaattataatggttgccacaatgattacgagtactacgttcattac
acagagtttaatagaagattggatgaatggattaagcttgaacagcttgaccttgattca
gtagagtgtgctttagatgaaaaagttgaagacaaggtgactagcttgaagatgacacga
caccagaaacggaagattgatgagactcatgtagagggtcatgaagagctggatgctgcg
agtttgcgtgaacacgaggagttcacgaaagtgaagaacatagctacgattgagcttggg
aagtatgagattgagacatggtacttctctccttttcctccagaatacaatgactgcgtg
aagctctttttctgtgagttttgcctcagttttatgaagcgcaaagagcagcttcaaagg
catatgaggaaatgcgatttgaagcacccccctggggatgaaatctatcgaagctctact
ttgtcaatgtttgaggtggatggcaagaagaataaggtctatgcacagaacctctgttat
ctggcaaagttatttcttgaccacaagactctttactatgacgttgatttgttcctgttc
tatattctctgtgaatgtgatgatcgtggatgccacatggttggatacttttcaaaggaa
aaacactcggaagaagcttacaacttggcttgcatccttacacttcctccatatcaaagg
aaaggctatggcaaattcctaatagccttctcctatgaactctcaaagaaagagggcaaa
gtcgggacaccggaaaggccgctctctgatctaggtttagtgagttacagaggttactgg
actcggattttattagacatcctgaaaaagcacaagggaaacatatctatcaaggagctg
agcgacatgacagcgattaaagcagaagatatattaagcaccctgcagagcttggaactg
atacaatacaggaaaggacaacacgtgatctgcgcggatcctaaggtactggaccgacac
ttgaaagcggcaggccgaggtggtcttgatgtggatgtgagcaaaatgatatggactcct
tacaaagagcagagctaa

DBGET integrated database retrieval system