KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_496706Help
Entry
ARALYDRAFT_496706 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ARALYDRAFT_496706
Enzymes [BR:aly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ARALYDRAFT_496706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 564 aa AA seqDB search
MSILSSSPSLCSSLNLFRLSSPVSLSDAAFGGNRTKPSQSFRMEAVSSSSTSISCISVGE
DFPAEYEQWLPVPDPESRRRAGVLLHPTSFRGPHGIGDLGDEAFRFIDWLHSTGCSVWQV
LPLVPPDEGGSPYAGQDANCGNTLLISLNELVKDGLLMTDELPQPIDADCVNYQTANKLK
SPLITKFTRIQQLTLIFKANDPSISCWLEDAAYFAAIDNTLNAYSWFEWPEPLKNRHLSA
LEAIYESQNEFIDLFIAKQFLFQRQWQKVREYARQQGVDIMGDMPIYVGYHSADVWANKK
HFLLASFPLLVSGVPPDLFSETGQLWGSPLYDWKAMESDQYSWWVNRIRRAQDLYDECRI
DHFRGFAGFWAVPSEAKVAMVGRWKVGPGKSLFDAISRGVGKIKIIAEDLGVITKDVVEL
RKSIGAPGMAVLQFAFGGGADNPHLPHNHEVNQVVYSGTHDNDTIRGWWDTLDKEEKSKA
MKYLSIAGEDAISWSVIQAAFSSTAQTAIIPMQDILGLGSSARMNTPATEVGNWGWRIPS
STSFDNLKTESDRLRDLLSLYGRL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcttagctcgtctccttcactctgttcttctctcaatcttttccgattatcc
tctccggtatcattatcggacgcagctttcggcgggaacaggacaaagccgtcgcagtcg
tttcgaatggaggccgtttcgagtagttccacttctatttcatgtattagcgtcggcgaa
gattttccagcagagtatgagcagtggctgccggttccggatccagagagcaggagaaga
gctggcgttttgctccacccgacgtcgtttcgcggtcctcatggcattggtgatctcgga
gatgaagccttccgcttcatcgattggcttcattctactggttgctccgtttggcaggtt
cttcctctggttccaccagacgaaggaggatctccttatgcaggacaggatgcaaattgt
gggaacacattgttgatttctctgaatgagcttgtcaaggacggcttgctaatgacggat
gagctcccacaaccaattgatgccgactgtgtgaactatcaaactgccaacaagttaaag
agtcccttgataactaagttcacacgaattcagcaacttactctcattttcaaagcaaac
gacccctctatatcatgttggcttgaagatgctgcttattttgcagctattgacaatact
ttaaatgcatacagttggtttgaatggcctgaaccgcttaaaaaccgtcatctttcggcc
ttggaagctatatatgaaagtcaaaacgagtttatagacttgttcattgctaagcaattt
ttgttccaaaggcaatggcagaaagttcgtgagtatgcacgtcagcaaggagttgatata
atgggagatatgcccatttatgtaggatatcacagtgcagacgtttgggcaaataagaaa
catttcttactggcaagctttcctcttcttgttagcggtgttcctcctgacttgttcagt
gaaactggtcaactgtggggaagccctctttatgactggaaagcaatggagagtgaccaa
tattcttggtgggttaatcgaatacgacgcgcacaggacttgtatgacgaatgcaggatt
gatcatttcagaggatttgcagggttttgggcggtcccttctgaagcaaaagtagccatg
gttggacgatggaaggtaggacctggaaagtcattatttgatgccatttccagaggcgtt
gggaagatcaaaatcatagctgaagatttgggagttattactaaagatgtagttgagctg
aggaaatctattggagcgcctggaatggcagtcctccaatttgcttttggaggaggcgcc
gataacccacatttacctcacaatcatgaagtaaaccaagttgtatactctggaactcat
gacaacgacactattcgaggttggtgggacactttggacaaagaagaaaagtctaaggca
atgaaatacttatcgatagctggagaagacgctatatcatggtcagtgatccaagctgca
ttctcttcaaccgctcaaaccgcaatcataccgatgcaagacattctaggacttggaagt
tctgccaggatgaacactccagccactgaggtggggaattggggttggaggattccgagt
tcaacgagctttgataatctgaaaactgaatctgacagactcagagatcttttgtcattg
tacggacggctttga

DBGET integrated database retrieval system