KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_656075Help
Entry
ARALYDRAFT_656075 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 493 aa AA seqDB search
MVSRRGSSDTKAIVCIFTDRIRFSNNWVSHLSFAGLLGAAGFVFAQQHGLFPNLNNLKLF
SGKEKDAGDDSVLVPGLQNLGNNCFLNVILQALASCKDFRSFLQWVLEDARDSVAGELEE
QLPLTYALSALLQELCTVGSRRSVSSPRKVMVALTDYATNFNLTSQQDAAEALLHLISSL
QEEIVVCYRPSQSCNLSDILFSRNLRMLAPSEGLLGLMELKRWHKHLRGPFDGILGSTLM
CRTCSSQISLEFQFFHTLPLSPLLHNGGYNIMFGCTLENCLNKFLNAEKVENYFCYRCWH
GAALKYLSVIGAAEIDIEMVRSCGGEDQCDCKTSHHLQRMPWSNSYSHILKQLIIARLPK
LLCIQVQRASFNMFEEFKLSGHIAFPLVLDLSLFTPTSIGLNIEERIEMSSEYQKPEASR
KHGMYRLVTVVEHFGRTGSGHYTVYRSVRVPSQEEEEDCEELCWFSISDSEVCRVSESDV
LGAEASLLFYERL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtttctcgtagaggttcttccgacacaaaggcgattgtgtgtatcttcacagataga
attaggttctccaacaactgggtttcgcatttgtcttttgctggtctacttggtgctgct
ggttttgtatttgcccaacaacacggtctattccccaacttaaacaacctaaaactcttc
tccggtaaagaaaaagacgccggagacgattctgttctcgtaccgggccttcaaaatctc
gggaataactgtttcctcaacgtcatcctccaggctctcgctagctgcaaagattttcgg
agttttcttcaatgggttttagaggatgcgagagattccgtagcaggagaactagaggaa
cagcttcctcttacttatgctttgtctgctttactacaagagctctgcactgttggaagt
agacgatctgtgtctagccctcgtaaagttatggtggcattgacagattatgccacaaat
ttcaatttgacaagccaacaggatgcagcagaagcccttcttcatcttatttcttctttg
caagaagagattgtagtctgttatcgtcctagccaaagttgtaatctttcggatatactt
ttctctcgcaacttgagaatgcttgcgcctagtgaaggcctccttggtttgatggagctc
aagagatggcataaacatttgcgtggaccatttgatgggattcttggtagtacgttgatg
tgccgaacttgttcgtctcagatttcgttggagtttcagttttttcatactctgcctctt
tctcctttactccataacggtggttacaacattatgtttggatgcactttggagaattgc
ttgaacaagtttctcaatgctgagaaagtcgaaaactacttctgctatagatgctggcat
ggtgctgcactgaaatatttatcggtgataggagcagctgagatagatattgaaatggtc
aggagctgtggcggagaggaccaatgtgactgtaaaacttctcatcatcttcaaagaatg
ccttggtcaaacagctattcccatatattgaagcagttaatcatcgcccgtttaccaaag
ctcctatgcattcaagtgcaacgtgcttcatttaacatgtttgaagaattcaaattatcg
ggacatatcgcatttccacttgtcttagacctctccttgttcacaccaacttcaataggc
ttaaacatagaagaaaggattgagatgtcttcagagtaccaaaagccagaagcatcaaga
aagcatggcatgtacaggcttgtgacggtggtggaacattttggtagaacgggaagcggg
cattacactgtttatagaagtgtgagagtgccatcacaagaggaagaagaagattgtgag
gaattgtgctggtttagtatatctgattcagaagtttgcagagtttcagagagtgatgtt
cttggtgctgaagctagcttgctcttctatgaaaggctgtga

DBGET integrated database retrieval system