KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_656540Help
Entry
ARALYDRAFT_656540 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aly00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aly00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aly00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 565 aa AA seqDB search
MRCLQNSAKILPLAFKSALLPLSQRWFCKFSPKPSSLANIFKVSVSTMANTLNGNVIMPS
KPQSTYQVVVAATKEMGIGKDGKLPWNLPTDLKFFKDLTLTTSDSAKKNAVVMGRKTWES
IPTKYRPLSGRLNVVLTRSSGVDIANTENVVTCSSIDSALDLLAAPPFSLSIEKVFVIGG
GDILREALNGPSCEAIHLTEIDTSIDCDTFIPAVDTSAYQPWCSSFPICENGLRFSFTTY
VRVKSSSACESSDVSDGSKVLQVDWKKFSSFLPKMIFDRHEEFLYLNLVKEIISNGNLKG
DRTGTGTLSKFGCQMKFNLRRNFPLLTTKRVFWRGVVEELLWFISGSTNAKVLQEKGIRI
WDGNASRAYLDGIGLTEREEGDLGPVYGFQWRHFGAKYTDMHADYTGQGFDQLLDVIHKI
KNNPDDRRIIMSAWNPSDLKLMALPPCHMFAQFYVADGELSCQMYQRSADMGLGVPFNIA
SYSLLTCILAHVCDLVPGDFIHVIGDAHVYKNHVRPLQEQLENPPKPFPVLKIKPEKKDI
DSFVSDDFELIGYDPHKKIDMKMAV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgtttgcaaaactccgcaaagattctacctttagcgtttaaatcggctttgctg
cctttgtctcaaaggtggttctgtaaattttctcctaagccatcctcattggcaaacatc
ttcaaggtttcagtttcaaccatggccaacactctcaatggaaatgtgatcatgccttca
aaacctcagagtacttaccaagttgtggtagctgcaaccaaggaaatgggtattggtaaa
gacggaaaacttccatggaatttgcctaccgatctcaagttcttcaaggatttaactttg
accacttcggattctgctaagaagaacgctgttgtaatgggtaggaaaacgtgggagtct
attcccacaaagtataggccactctctggtcgcctgaatgttgtcttgactcgttcaagc
ggtgtcgatatagccaacactgagaatgttgtaacttgcagtagcatagattctgctctg
gacttattagctgcacctccgtttagtctgtccattgagaaggtgtttgtaataggaggt
ggagacatattgagggaagcgttgaatggaccgagctgtgaagccatccacttaacggag
attgatacaagtattgactgtgatacatttattcccgcggttgacacatctgcatatcag
ccttggtgttcgtcatttccaatatgtgaaaatggacttcgattttccttcacgacttat
gttcgtgtaaagagttcttctgcctgtgaatcctctgatgtgagtgatgggtcaaaggtc
cttcaagttgattggaaaaagttttcttcttttcttcctaagatgatttttgaccgtcat
gaagaatttctatacttgaatctggtcaaagagataatctcaaatggaaacttaaagggc
gataggacagggactggtacattatctaaatttggttgtcagatgaaattcaatttacgc
aggaattttccacttctgacgacaaagagagttttctggagaggtgttgttgaggaactt
ctatggttcataagcggttcaaccaatgcaaaggtacttcaagaaaagggtatccgtata
tgggatgggaatgcgtcgagagcatatcttgatggtattggactgactgagagagaagaa
ggtgaccttggacccgtttatggatttcagtggagacactttggtgctaagtacacagat
atgcatgctgattatacggggcaaggatttgatcagctcttagatgtaattcacaagatc
aagaacaatcctgatgatcgacggattataatgtcggcttggaatccttctgatcttaag
ctgatggcacttcctccatgccacatgtttgcacagttttatgttgcagatggagaactg
tcatgtcaaatgtatcagcgctcagccgatatgggtctcggcgtaccgtttaacattgca
tcatactcccttcttacatgcattctcgctcacgtctgtgatcttgttcctggtgatttt
atccatgtgattggagatgctcatgtttacaaaaaccatgtcaggcctctgcaagagcaa
cttgagaacccaccgaaaccttttcctgttttgaagataaaaccggagaagaaagatata
gattcttttgtgtcggatgactttgagctcattggctatgatcctcacaagaaaatagat
atgaaaatggcggtttag

DBGET integrated database retrieval system