KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_660232Help
Entry
ARALYDRAFT_660232 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_660232
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ARALYDRAFT_660232
   00630 Glyoxylate and dicarboxylate metabolism
    ARALYDRAFT_660232
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ARALYDRAFT_660232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 562 aa AA seqDB search
MELETSVYRPNVAVYDSPDGVEVRGRYDQIFAKILTREALNFVAELQREFRGHVRYAMEC
RREARRRYNSGAVPGFDPSTKFIRDGDWICASVPPAVADRRVEITGPVERKMIINALNSG
AKVFMADFEDALSPSWENLMRGHVNLKDAVDGSITFHDKSRNRVYKLNDQTAKLFVRPRG
WHLPEAHILIDGEPATGCLVDFGLYFFHNYAKFRQTQGSGFGPFFYLPKMEHSREAKIWN
SVFERAEKMAGIERGSIRATVLIETLPAVFQMNEILYELRDHTVGLNCGRWDYIFSYVKT
FQAHPDRLLPDRVLVGMGQHFMRSYSDLLIRTCHKRGVHAMGGMAAQIPIRDDPKANEMA
LDLVRKDKLREVRAGHDGTWAAHPGLIPICMEAFTGHMGKSPNQIKSVKREDAAAITEED
LLQIPRGVRTLEGLRLNTRVGIQYLAAWLTGSGSVPLYNLMEDAATAEISRVQNWQWIRY
GVELDGDGLGVRVTKELFGRVVEEEMERIEKEVGKDKFKKGMYKEACKMFTKQCTAPELD
DFLTLAVYNHIVAHYPINNSRL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgagacctcagtttatcgaccaaacgtcgccgtctatgattctccggatggt
gtcgaggttcgaggacggtacgaccaaatcttcgctaagattttgacaagagaagctctt
aactttgtggctgagttacagagagagtttcgtggccatgtgaggtatgccatggagtgc
cggagagaggcacgacggcgttacaactccggtgccgttcctgggtttgatccttccact
aagttcatcagagacggtgattggatctgtgcctccgtccctcccgccgttgctgaccgg
agagttgagataaccggtccggtcgagaggaagatgatcatcaacgctcttaactccgga
gctaaagtcttcatggctgatttcgaggacgcattgtctccgagttgggagaatctgatg
agagggcatgtgaacttgaaagatgcagtggatggatccattacgttccatgacaagtca
aggaacagagtttataagctcaacgaccaaaccgctaagctctttgtccggccaagaggt
tggcatctcccggaggctcacatcctcatcgacggtgaacccgccactggatgtcttgtc
gattttggcctttacttcttccacaactacgccaaatttagacagactcaaggttccgga
tttggtccattcttctatctccccaaaatggaacattctagggaagcaaagatttggaac
agcgtgtttgagcgagctgagaagatggctgggatagagagaggaagcattagagcaaca
gtgctgatcgagaccctcccggctgtcttccagatgaatgagatactatatgaactgcgt
gatcacactgtcggtttaaactgtggaagatgggattatatcttcagttatgtcaagacc
ttccaagctcaccctgaccggctcttaccagaccgtgtcctagtcggcatgggccagcat
ttcatgagaagttactctgaccttctcatccgtacttgtcataagcgcggtgtccacgct
atgggtggcatggcggctcagattccaataagagatgacccgaaagcgaatgagatggca
ttggatctagtgaggaaagacaagctaagagaagtaagagctgggcatgatgggacatgg
gcggctcatccaggactcatcccaatatgcatggaagcattcacaggccacatgggcaaa
agtccaaaccaaatcaaatcagtgaagcgcgaagatgcagccgcgataacagaggaagat
ctgcttcaaataccgcgaggagtgcgaacactcgagggtctaaggctgaacacacgtgtg
ggaatccaatacttagctgcgtggttaacaggatcaggatctgtcccactatacaaccta
atggaagacgcggctacggctgagataagccgagtccagaattggcaatggattaggtat
ggagtggaattggatggagacgggctcggagttcgggtgactaaagagttatttgggaga
gttgtggaagaagagatggagagaattgagaaagaagttgggaaagacaagttcaagaaa
ggaatgtataaggaagcttgcaagatgtttacaaagcagtgtaccgcgcctgaacttgac
gatttcctcacacttgccgtctataatcacattgtagctcactaccctatcaataactct
aggctctga

DBGET integrated database retrieval system