KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_666113Help
Entry
ARALYDRAFT_666113 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ARALYDRAFT_666113
   00500 Starch and sucrose metabolism
    ARALYDRAFT_666113
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ARALYDRAFT_666113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 590 aa AA seqDB search
MSASKLVSVLLLIVLINISNNGVDAFHKIFKKLQSQSTSLDSVSPLHRTAYHFQPPRHWI
NDPNAPMLYKGIYHLFYQYNPKGAVWGNIVWAHSVSKDLINWEALEPAIYPSKWFDINGT
WSGSSTHVPGKGPVILYTGITENQTQIQNYAIPQDLSDPYLKTWIKPDDNPIVKPDHGEN
GSAFRDPTTAWFNKKDGYWRMLVGSKKKHRGIAYMYKSRDFKKWVKTKRPIHSRKKTGMW
ECPDFFPVSVTDKKNGLDFSYDGPNAKHVLKVSLDLTRYEYYTLGKYDTKKDRYRPDGNT
PDGWDGLRFDYGNFYASKTFFDDKKKRRILWGWANESDTVEDDTLKGWAGVQLIPRTILL
DYSGKQLVFWPIEEIESLRGKNVQMTNQKMEMGQRFEVQGITPAQVDVDVTFNVGSLEKA
EKFDASFTTKPLELCNLKGSNVTGGVGPFGLITLATSDLEEYTPVFFRVFKDASTNKPKV
LMCSDAKPSSLKTDTGSDAKQRMYKPSFAGFVDVDLADGKISLRSLIDHSVVESFGAKGK
TVITSRVYPTKAVGEKAHLFVFNNGSQPVTVESLNAWNMQKPLKMNQGAK
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttcaaagcttgtttctgtattactattgattgtattaatcaatataagcaat
aatggcgtcgatgcatttcacaaaattttcaagaaattgcaatcacaatcgacatcattg
gattcagtgagtcctcttcacagaaccgcatatcactttcaacctccccgccattggatc
aacgatccgaatgctccaatgctctacaagggaatctaccatctcttctaccaatacaat
cccaaaggtgcggtttggggtaacattgtgtgggctcactcggtttctaaggacttgatc
aattgggaagcccttgaaccagctatttacccatccaaatggttcgacatcaacggtaca
tggtccggttcatctacccacgtaccgggcaaaggaccggtcatcctctacaccggtatc
accgagaaccagactcaaattcaaaactatgcaattccacaagacctttccgatccatac
ctcaagacatggattaaaccagacgataacccaatcgtaaaacccgatcatggcgagaac
ggatccgctttccgtgacccaaccacggcttggttcaacaaaaaagatgggtattggaga
atgcttgttggctcaaagaaaaagcacagaggaatcgcttatatgtacaaaagtcgtgac
ttcaagaaatgggtcaaaaccaaacgtcctatccactccagaaagaagaccggtatgtgg
gaatgtcccgatttcttcccggtatccgtaaccgacaagaaaaacggtttggacttcagc
tacgacggtccaaacgccaagcatgtgttgaaggttagtttggacttgacccgatacgag
tactatactcttggaaagtatgacaccaagaaggatcgatacagaccagacggtaacact
cctgacggttgggatggtttgagatttgattatggtaacttctatgcgtcaaagacattc
tttgatgacaagaagaagagaagaattctttggggttgggccaatgaatccgacaccgtt
gaagatgatacgttgaagggttgggccggagttcagcttatcccacgaacaatcttgctt
gactatagcggtaagcaactcgtgttttggcctattgaagagattgagtcattgagagga
aagaatgtccaaatgaccaaccagaaaatggagatgggccaacgctttgaggtccaagga
atcactcctgctcaggtggatgtggatgtgacattcaacgttggaagtctagagaaagcc
gaaaagttcgacgcaagcttcacaactaaaccactagagttatgtaacttgaaaggttca
aatgtgactggcggagtcggtccttttggtctgatcacgttggctacatctgacctagaa
gaatacactcctgttttcttcagagtcttcaaagatgcctcaaccaacaagcctaaggtc
ctcatgtgctctgacgccaagccttcgagtctcaaaacagacacaggctctgacgcaaag
cagaggatgtacaaaccctcgtttgctggttttgttgatgttgatctcgctgacggaaag
atctctctaaggagtttgattgatcactcggtggtggagagctttggtgcaaaaggaaag
acagtgataacatctagagtatatccgacaaaagcagtaggagaaaaagctcatttgttt
gtctttaacaacggatcacagcctgtgaccgtagagagcctcaatgcatggaacatgcag
aagcctctgaagatgaaccaaggagctaaatga

DBGET integrated database retrieval system