KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_670486Help
Entry
ARALYDRAFT_670486 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARALYDRAFT_670486
   00500 Starch and sucrose metabolism
    ARALYDRAFT_670486
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ARALYDRAFT_670486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 511 aa AA seqDB search
MMAFRAYIITFVFLCILVASTVSGYNQKDVKAWCSQTPNPKPCEYFLTHNSNNKPIKSES
EFLEISMKLALDRAVLAKTHAFTLGPKCRDTREKAAWEDCIKLYDLTVSKINETMDPNVK
CSKTDAQTWLSTALTNLDTCRAGFLELGVTDVVLPLMSNNVSNLLCNTLAINKVPFNYTP
PEKDGFPSWVKPGDRKLLQSSTPKDNAVVAKDGSGNFKTIKDAINAASGSGRFVIYVKQG
VYSENLEIRKKNVMLRGDGIGKTIITGSKSVGGGTTTFNSATVAAVGDGFIARGITFRNT
AGANNAQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGTVDFIFGNAAAV
LQNCNIFARRPRSKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTYLGRPW
RQYSRTVFMKTSLDSLIDPRGWLEWNGNFALKTLFYAEFQNTGPGASTSGRVTWPGFRVL
GSASEASKFTVGTFLAGSSWIPSTVPFTSGL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttttcgagcttatattattacctttgtgttcttatgcatcctcgtggcatcg
accgtttccgggtacaaccagaaagacgtgaaagcgtggtgcagccaaactccaaaccct
aaaccttgcgagtatttcctaacccataactcaaacaataaacccataaagtctgaatcc
gagttcctcgaaatctcaatgaaactcgcattagaccgagccgtcctcgccaaaacccac
gcgttcacactaggaccaaagtgtcgtgacacacgtgaaaaagcagcgtgggaagattgt
atcaagctctatgacctcaccgtctctaaaatcaacgagacaatggaccccaacgtgaag
tgctcaaaaactgacgcgcaaacatggctaagcacagctctaaccaatcttgacacgtgt
cgagccgggttcttagagcttggtgttaccgatgtcgtccttcctttgatgtcaaacaac
gtctcgaatcttttatgcaacacactcgccattaacaaagttcctttcaactacacccca
cccgagaaagacgggttcccgtcgtgggtcaaacctggtgaccggaaacttttgcaaagc
tcgacgccaaaagataacgcagtggtggcgaaagacgggtctggtaatttcaagacaata
aaagatgcgattaatgctgcttcggggagtggtaggttcgtgatatatgtgaagcaaggc
gtctacagtgagaatcttgagattcgaaaaaagaatgttatgttgagaggtgatggtata
gggaagacgattattaccggaagcaaaagtgttggaggaggaacgacaacgtttaattca
gctactgtcgctgcggtcggagacgggtttatcgctcgtgggatcacgtttcgaaacacg
gcgggtgcaaacaacgcacaagcagtagctctaagatccgggtcggatctatccgttttt
taccaatgcagtttcgaagcttaccaagacacactctacgttcactccaaccgtcagttt
taccgcgattgcgacgtttatggaactgtcgattttatcttcggaaacgcagcagcggtt
ctccagaactgcaacatcttcgcacgtcgtccacgtagtaagaccaacacaatcaccgct
caaggaagatccgacccgaatcaaaacacgggtattattatccacaactctcgggtcacc
gccgcttcggatcttcgacccgttttgggatccaccaagacttatttgggtcgaccttgg
agacaatattctagaacagtttttatgaagacttctcttgatagtttgattgatccacgt
ggctggctcgagtggaatggtaatttcgctttgaagactttgttctatgctgagtttcaa
aatacgggtccgggtgcttcaacttcgggtcgggtcacatggccagggtttcgggtcctt
ggttctgcttcagaggcttccaagtttactgttggtactttccttgccggtagctcttgg
attccatctaccgtaccgttcacttctggtctctaa

DBGET integrated database retrieval system