KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_675475Help
Entry
ARALYDRAFT_675475 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 376 aa AA seqDB search
MATPVDPPNGIRNQGKHYFSMWQTLFEIDTKYVPIKPIGRGAYGVVCSSVNRESNERVAI
KKIHNVFENRIDALRTLRELKLLRHLRHENVVALKDVMMANNKRSFKDVYLVSELMDTDL
HQIIKSSQVLSNDHCQYFLFQLLRGLKYIHSANILHRDLKPGNLLVNANCDLKICDFGLA
RTSNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQIKLIINILGSQREEDLEFIDNPKAKRYIESLPYSPGISFSRLYPNAHVLAIDLLQKML
VLDPSKRISVTEALQHPYMAPLYDPNANPPAQVPIDLDVDEDEDLGAEMIRELMWKEMIH
YHPEAATMNNNELSEF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggcgactccggttgatccaccaaatggaataaggaatcaagggaagcattacttctca
atgtggcaaacacttttcgagattgatacgaaatacgtgcctattaaaccgataggccga
ggcgcgtacggtgtagtttgttcttcggttaacagagagagtaatgagagagtggcgatc
aagaagatccacaatgtgtttgagaatcggattgatgcgttgaggactcttagggaactt
aagcttttacgtcatcttcgacatgagaatgtggttgctcttaaagatgtaatgatggct
aacaataagagaagctttaaggatgtgtatcttgtttctgagcttatggatactgatctt
catcagattatcaagtcgtctcaagtgctaagtaatgaccattgtcaatacttcttgttc
cagttgcttcgtgggctcaagtatattcattcagcaaacattctccatcgggatctgaaa
cccggtaaccttcttgtgaatgcaaactgcgacttaaagatatgcgattttgggctagcg
aggacgagcaacaccaaaggtcagttcatgactgaatatgttgtgactagatggtaccga
gcaccagagcttctcctctgttgtgacaactacggaacctccattgatgtctggtcagtt
ggttgcatattcgccgagcttcttggaagaaaacctatattccctggaacagaatgtcta
aaccagattaaactcatcattaacattttgggaagccagagagaggaagatctcgagttt
atagataacccgaaagccaaaagatacatagaatcactcccttactcaccgggaatatca
ttctctcgtctttacccaaatgcacacgttctagccatcgatctgcttcagaaaatgctc
gttcttgacccttcaaaaaggattagtgtcacggaagcgcttcagcatccttacatggcg
cctttatacgacccgaatgcaaatccacctgctcaagttcctattgatcttgatgtagac
gaagacgaggatttgggagcagagatgataagagagttaatgtggaaggaaatgattcat
tatcatccagaagctgctaccatgaacaacaatgagctctctgagttttga

DBGET integrated database retrieval system