KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_676841Help
Entry
ARALYDRAFT_676841 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ARALYDRAFT_676841
  Lipid metabolism
   00600 Sphingolipid metabolism
    ARALYDRAFT_676841
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    ARALYDRAFT_676841
   00604 Glycosphingolipid biosynthesis - ganglio series
    ARALYDRAFT_676841
   00511 Other glycan degradation
    ARALYDRAFT_676841
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     ARALYDRAFT_676841
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARALYDRAFT_676841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 686 aa AA seqDB search
MAMTSRRSWPSTGRQTRHQLAFVLLLVLVAVGIYVPVLALPSLSLPPEIPGDEKMIMMSR
KFYIKDDSFWKDGNHFQIIGGDLHYFRVLPEYWEDRLLRAKALGLNTIQVYVPWNLHEPK
PGKMVFEGIGDLVSFLKLCDKLDFMVMLRAGPYICGEWDLGGFPAWLLSVKPRLQLRTSD
PAYLKLVERWWGVLLPKIFPLIYSNGGPVIMVQIENEYGSYGNDKAYLRKLVSMARGHLG
DDIIVYTTDGGTKETLEKGTVPVDDVYSAVDFTTGDDPWPIFELQKKFNAPGSSPPLSSE
FYTGWLTHWGEKIAKTDAEFTATSLEKILSRNGSAVLYMVHGGTNFGFYNGANTGSEESD
YKPDLTSYDYDAPIKESGDIDNPKFRALQRVIKKYNVASHSIIPSNKQRKAYGPIKMQMT
TSLIDLVSMADPADVIISANPISMESAGQMFGFVLYESSYIAKKSGNILRIPKVHDRAQV
FVSCLSQDVGVLRYIGTTERWNNQPVSLPTIECTTNTSLFILVENMGRVNYGPYIFDEKG
ILSSVYLDGQILHGWKMIPIPFHNLNQVPNISFEMQHTKKRNVVGQKEPALFAGEFSINT
TEEIEDTYLSFNGWGKGVAFINEFNIGRYWPSVGPQCNLYVPAPLLKPGKNTLVIFELES
PHLELLLESVDQEDFVCGSYDSKVSQ
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgacaagcaggcgtagctggccatcaacgggaagacaaacaagacatcaattg
gctttcgtgttgctcctggttcttgtagctgtcggaatctatgtgcccgtcttagctctt
ccttcattgtctctgcctcctgaaatacctggggacgagaagatgataatgatgtcaagg
aagttttatatcaaagatgacagtttctggaaagatgggaatcattttcagatcatcggt
ggtgatttgcactacttccgtgttcttcctgagtactgggaggatcggcttctaagagcc
aaggctttaggcctgaatactattcaagtatacgttccttggaatctgcatgaaccaaag
cctgggaagatggtttttgagggtattggtgatcttgtgtcctttctcaagctatgtgat
aaactagattttatggttatgctgcgtgctggaccttacatctgtggagaatgggatttg
gggggctttcctgcttggttactttctgtgaaaccacgtctccaactaaggacatcagat
cctgcatatcttaagttggttgaaagatggtggggtgttctgttaccgaagatatttcct
ctaatttacagcaatgggggtcctgttataatggttcagattgaaaatgaatatggttca
tatggaaatgacaaagcctatcttcgtaagctagttagtatggctaggggacacctgggg
gatgacattattgtgtacacaacagatggagggacaaaagaaactcttgagaaaggaact
gtccctgtagatgatgtctactcagctgttgatttcacaaccggtgatgatccttggcca
atatttgaattgcaaaagaagtttaatgctccaggaagctcacctccactttcctcggag
ttttatactggttggctaacacattggggtgaaaagatagcaaaaactgatgctgaattc
acggcaacttctcttgaaaaaatactgtctcgaaatggttctgctgtgctctatatggtg
catggaggaacaaactttggtttctacaatggtgcaaatactggctctgaagaatctgac
tataaaccagatctgacatcctatgactatgatgctcccattaaggagtctggtgacata
gataatccaaaattccgagctcttcagagagtgattaagaagtacaatgttgcatcacac
tccattatcccctccaataagcaacggaaagcgtatggtcctatcaagatgcagatgaca
acttcgctgattgatttagttagtatggcagatcctgcagatgtgatcatctccgccaac
ccaatttcaatggaatctgctggacagatgttcggatttgttttatatgagtcttcatac
atcgcaaagaagagtgggaatatactaagaatacccaaggttcatgacagagctcaagtt
tttgtttcatgtctttcccaagatgtgggagtactgagatacattggtacaactgagaga
tggaacaaccaacctgtttctcttccaactattgagtgcaccacaaacacgagcttattt
attctggttgaaaacatgggtcgtgtaaactatgggccatatatctttgatgagaagggt
atactgtcttcggtatatctagatggtcaaattctccatggatggaagatgataccaatt
ccgtttcacaacctaaatcaagtgccaaatatcagtttcgagatgcaacatactaaaaag
agaaatgtcgtcggtcaaaaggaaccagctctgtttgctggtgagttctctatcaacact
acagaagaaatcgaagacacgtacttatcattcaacggttggggtaaaggagttgctttt
atcaatgaattcaacattggaagatattggccgtctgttggaccacagtgcaacctctat
gttcctgcgccgcttcttaagcctggcaaaaatactttggtaattttcgagttggaatct
ccgcatctcgagcttttactggagtcagtggatcaagaagacttcgtatgcggttcttat
gattccaaagttagtcagtag

DBGET integrated database retrieval system