KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_676841Help
Entry
ARALYDRAFT_676841 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aly00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:aly00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:aly00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:aly00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aly00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 686 aa AA seqDB search
MAMTSRRSWPSTGRQTRHQLAFVLLLVLVAVGIYVPVLALPSLSLPPEIPGDEKMIMMSR
KFYIKDDSFWKDGNHFQIIGGDLHYFRVLPEYWEDRLLRAKALGLNTIQVYVPWNLHEPK
PGKMVFEGIGDLVSFLKLCDKLDFMVMLRAGPYICGEWDLGGFPAWLLSVKPRLQLRTSD
PAYLKLVERWWGVLLPKIFPLIYSNGGPVIMVQIENEYGSYGNDKAYLRKLVSMARGHLG
DDIIVYTTDGGTKETLEKGTVPVDDVYSAVDFTTGDDPWPIFELQKKFNAPGSSPPLSSE
FYTGWLTHWGEKIAKTDAEFTATSLEKILSRNGSAVLYMVHGGTNFGFYNGANTGSEESD
YKPDLTSYDYDAPIKESGDIDNPKFRALQRVIKKYNVASHSIIPSNKQRKAYGPIKMQMT
TSLIDLVSMADPADVIISANPISMESAGQMFGFVLYESSYIAKKSGNILRIPKVHDRAQV
FVSCLSQDVGVLRYIGTTERWNNQPVSLPTIECTTNTSLFILVENMGRVNYGPYIFDEKG
ILSSVYLDGQILHGWKMIPIPFHNLNQVPNISFEMQHTKKRNVVGQKEPALFAGEFSINT
TEEIEDTYLSFNGWGKGVAFINEFNIGRYWPSVGPQCNLYVPAPLLKPGKNTLVIFELES
PHLELLLESVDQEDFVCGSYDSKVSQ
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgacaagcaggcgtagctggccatcaacgggaagacaaacaagacatcaattg
gctttcgtgttgctcctggttcttgtagctgtcggaatctatgtgcccgtcttagctctt
ccttcattgtctctgcctcctgaaatacctggggacgagaagatgataatgatgtcaagg
aagttttatatcaaagatgacagtttctggaaagatgggaatcattttcagatcatcggt
ggtgatttgcactacttccgtgttcttcctgagtactgggaggatcggcttctaagagcc
aaggctttaggcctgaatactattcaagtatacgttccttggaatctgcatgaaccaaag
cctgggaagatggtttttgagggtattggtgatcttgtgtcctttctcaagctatgtgat
aaactagattttatggttatgctgcgtgctggaccttacatctgtggagaatgggatttg
gggggctttcctgcttggttactttctgtgaaaccacgtctccaactaaggacatcagat
cctgcatatcttaagttggttgaaagatggtggggtgttctgttaccgaagatatttcct
ctaatttacagcaatgggggtcctgttataatggttcagattgaaaatgaatatggttca
tatggaaatgacaaagcctatcttcgtaagctagttagtatggctaggggacacctgggg
gatgacattattgtgtacacaacagatggagggacaaaagaaactcttgagaaaggaact
gtccctgtagatgatgtctactcagctgttgatttcacaaccggtgatgatccttggcca
atatttgaattgcaaaagaagtttaatgctccaggaagctcacctccactttcctcggag
ttttatactggttggctaacacattggggtgaaaagatagcaaaaactgatgctgaattc
acggcaacttctcttgaaaaaatactgtctcgaaatggttctgctgtgctctatatggtg
catggaggaacaaactttggtttctacaatggtgcaaatactggctctgaagaatctgac
tataaaccagatctgacatcctatgactatgatgctcccattaaggagtctggtgacata
gataatccaaaattccgagctcttcagagagtgattaagaagtacaatgttgcatcacac
tccattatcccctccaataagcaacggaaagcgtatggtcctatcaagatgcagatgaca
acttcgctgattgatttagttagtatggcagatcctgcagatgtgatcatctccgccaac
ccaatttcaatggaatctgctggacagatgttcggatttgttttatatgagtcttcatac
atcgcaaagaagagtgggaatatactaagaatacccaaggttcatgacagagctcaagtt
tttgtttcatgtctttcccaagatgtgggagtactgagatacattggtacaactgagaga
tggaacaaccaacctgtttctcttccaactattgagtgcaccacaaacacgagcttattt
attctggttgaaaacatgggtcgtgtaaactatgggccatatatctttgatgagaagggt
atactgtcttcggtatatctagatggtcaaattctccatggatggaagatgataccaatt
ccgtttcacaacctaaatcaagtgccaaatatcagtttcgagatgcaacatactaaaaag
agaaatgtcgtcggtcaaaaggaaccagctctgtttgctggtgagttctctatcaacact
acagaagaaatcgaagacacgtacttatcattcaacggttggggtaaaggagttgctttt
atcaatgaattcaacattggaagatattggccgtctgttggaccacagtgcaacctctat
gttcctgcgccgcttcttaagcctggcaaaaatactttggtaattttcgagttggaatct
ccgcatctcgagcttttactggagtcagtggatcaagaagacttcgtatgcggttcttat
gattccaaagttagtcagtag

DBGET integrated database retrieval system