KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_679406Help
Entry
ARALYDRAFT_679406 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     ARALYDRAFT_679406
Transcription factors [BR:aly03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    ARALYDRAFT_679406
Mitochondrial biogenesis [BR:aly03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    ARALYDRAFT_679406
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1685 aa AA seqDB search
MNVQAHMSGQLSGQVPNQGTIPQNNGNSQMQNVVGGTGVATGAGTATGVRPARNIVGAMD
HDIMKLRQYMQTLVFNMLQQRQPSPADAASKAKYMDVARRLEEGLFKMAITKEDYMNRTT
LESRITSLIKGRQMNNYNQRHANSSSVGTMIPTPGLSQNAGNPNLMVTSSVDATIVGNTN
ITSTAVNTGNPLIAGGMHGGNMSNGYQHSSRNFSLGSGGSMTSMGSQRSTGQMIPTPGFV
NSVTNNNSGGFSAEPTIVPQSQQQQHTGGQNSHMLSNQMDAGLRPDMQSKPYGVANSSVN
GGVGANEKSVDSGSSYTNASKKLQQGNFSLFSFCPDYTYTSQHIESTFHISGEGYSTTNP
DPFDGAITSVGTRTNAQNINTASLQRVSRVSSSLSHQQQFQQPPNRFQQQPNQIQQQQQQ
FLNQRKLKQQTLQQHRLISNAGLGKNQVDSDMITKVKHEPESQAAHSQASERFQLSQLQN
QYQNSGEDCHADAQLLPVKSQSDICTPLPQNSQQIQQMLHPQNIGSDSGNSFSNLAVGVK
SESNPRGQWPSKSQENTQMSNAISSEKHSQEDFRQRITGMDEAQPNNLTEGSVIGQNHTS
TISESHNLQNSIGTTCRYGNVSHDPKFKNQQRWLLFLRHARSCKPPGGKCQDQNCVTVQK
LWSHMDNCADPQCLYPRCRHTKALIGHYKNCKDPRCPVCVPVKTYQQQANVRALARLKNE
SSAVSSVNRSVVSNDSLRANGGSVSGTPRCADTLDNLQPSLKRLKVEQSFQPVVPKTESC
KSSIVSTTDAEFSEDAERKDHRLLKSEILEVKVEIPDISVQAGFGIKETKSEPFENVPKP
KPVSEPGKHGLSGDSPKQENIKTEKEPGRPKKEDLVESPELTSKSGKPKIKGVSLTELFT
PEQVREHIRGLRQWVGQSKAKAEKNQAMENSMSENSCQLCAVEKLTFEPPPIYCTPCGAR
IKRNAMYYTLGGGETRHYFCIPCYNESRGDSILAEGKSIPKEKLEKKKNDEETEEWWVQC
DKCEAWQHQICALFNGRRNDGGQAEYTCPNCYIIEVEQNERKPLLQSAVLGAKDLPRTIL
SDHIEQRLFRRLKQERTERARVQGTSYDEIPTAESLVVRVVSSVDKKLEVKSRFLEIFRE
DNFPTEFPYKSKVVLLFQKIEGVEVCLFGMYVQEFGSECSNPNQRRIYLSYLDSVKYFRP
DIKSANGEALRTFVYHEILIGYLEYCKLRGFTSCYIWACPPLKGEDYILYCHPEIQKTPK
SDKLREWYLAMLRKAAKEGIVAETTNLYDHFFLQTGECRAKVTAARLPYFDGDYWPGAAE
DIIYQMSQEDDGRKGNKKGILKKPITKRALKASGQSDLSGNASKDLLLMHKLGETIHPMK
EDFIMVHLQHCCTHCCSLMVTGNRWVCSQCKDYQLCDGCYEAEQKREDRERHPVNHKDKH
KLFPVEIADIPTDTKDRDEILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHL
HNPTAPAFVTTCNACHLDIESGQGWRCEVCPDYDVCNACYNKEGCINHPHKLTNHPSLAE
QNAQNKEARQLRVLQLRKMLDLLVHASQCRSPLCQYPNCRKVKGLFRHGLRCKIRASGGC
VLCKKMWYLLQLHARACKESKCDVPRCGDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAEV
AGTSG
NT seq 5058 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcaggctcacatgtcgggacaactctctgggcaggttccaaaccaagggaca
atcccgcagaataatggaaactctcaaatgcagaatgtagttggtggtactggtgttgct
actggtgctggtactgctactggggtaaggcctgcacgtaacatcgttggtgccatggat
cacgatattatgaaacttcgacagtatatgcaaactcttgtatttaacatgttacagcaa
cggcaaccatctcctgctgatgctgcatcaaaggcaaagtatatggatgttgctagacgt
ttagaagaggggctgtttaagatggctatcacaaaggaggattacatgaaccggacaacc
cttgaatctcggattacaagcctaataaaaggcagacagatgaataactacaatcagcga
catgctaattcttcttcggttggaacgatgatacctactccaggattatcacagaatgcg
ggtaatcctaatttgatggttacatcctctgttgatgctacaatagttggcaacaccaac
atcacaagcacagctgtgaacactggaaaccctctaattgctggtggcatgcatggaggt
aatatgtctaatggataccagcactcatcgagaaacttttctcttggttctggagggagc
atgacatccatgggttctcaaagaagtactggccaaatgattcctacacctgggttcgtt
aacagtgttactaataacaacagtggtggattttctgctgagcccacaattgtacctcag
tctcagcaacagcaacatactggtggtcaaaatagtcacatgttgtccaaccaaatggat
gctggccttagacccgacatgcaatcaaagccatatggtgtggccaatagctctgtaaat
ggtggtgttggagcgaacgaaaaaagtgtagactcaggttcatcttacactaatgcgtcc
aaaaaattacagcagggtaacttctctcttttttccttctgtccggattatacatatacc
agtcagcatattgaaagcacgtttcatatttcaggggaaggttatagcacaacaaatcct
gaccccttcgatggagctataacatcggttgggacgaggacaaatgctcagaatatcaat
acagcaagtttacagcgtgtgtccagagttagctcttctctgtcacatcaacaacaattt
cagcaaccgcctaatcgatttcagcaacaaccaaatcagattcaacagcagcagcagcaa
tttctcaatcaaaggaaattgaagcagcagactctgcagcaacatagattaataagcaat
gctggcttggggaaaaatcaagtggattcagacatgattacgaaggtgaaacatgaacct
gagagtcaggctgcgcactcccaagcatctgaacgattccagctttctcagctccagaat
caatatcagaactctggagaagactgccatgcagacgctcagcttctcccagtcaaaagt
cagagtgatatatgcacaccactccctcaaaatagccaacagattcagcaaatgctgcac
ccgcagaatataggttctgattctggcaacagttttagcaatcttgctgttggagtaaaa
tcagaatccaatccacgaggtcagtggccttccaagtctcaggaaaatactcaaatgtct
aatgctatttcaagtgaaaagcacagtcaggaggatttccgtcaaagaattaccggaatg
gatgaagctcaacctaataatttgactgaagggtctgttattggtcaaaatcatacttct
actatatcggaatcccataatttgcaaaattctattggtaccacatgtagatatggaaat
gtaagtcacgatcccaagttcaaaaatcaacagagatggctcctgtttcttcgtcatgca
cggagttgcaaaccaccaggagggaagtgccaagatcaaaattgcgtaacggttcagaaa
ctatggagtcacatggacaactgtgctgatcctcagtgtttgtatccccgctgtcgtcac
acaaaggcattgattggccactataaaaactgcaaggatccacggtgccccgtctgtgtg
ccagtgaagacctatcagcaacaagctaatgtgcgcgccctggcccgtttaaaaaacgaa
agcagtgctgtcagctcagtgaatagatctgtagtatcaaatgattcactacgcgctaat
gggggatcggtttctggtacccctcgttgtgctgatactttagataatttgcaaccttca
ttaaagcggttgaaggtggagcagtcttttcaaccagtggtccctaagactgaaagttgt
aaaagctccattgtttctacaacagatgcagaattttctgaggatgctgaaagaaaggat
cataggctgttgaagtcagagatcttggaagtgaaagtggaaattcctgatatttctgtt
caagcaggattcggcatcaaagaaacaaaaagtgaaccttttgaaaatgttcccaagcct
aagcctgtcagtgaaccaggtaaacatggtttatctggtgactcgccaaagcaagaaaac
atcaaaacggagaaagagcctggacggccgaagaaagaagatctggtggagtctcctgaa
cttacatcaaaatctggaaaaccaaagataaagggtgtttctttaactgaattgttcact
cccgaacaagtgagagagcatattcgtggtcttcgtcagtgggttggccagagtaaagcc
aaagcagaaaagaatcaggcgatggagaattcgatgagtgagaattcctgccagttatgt
gcggtggagaagcttacatttgagccaccacctatttattgtactccttgtggtgctcga
atcaagaggaatgcgatgtactatactcttggaggtggtgaaactcgtcattacttttgt
attccctgttataatgaatcccgaggagacagtattctcgctgaagggaagtcaatacca
aaggaaaagctcgagaaaaagaaaaacgatgaagagactgaagaatggtgggtccaatgt
gataaatgtgaggcctggcagcatcaaatatgtgctctatttaatgggcggaggaatgat
ggggggcaagctgagtatacctgcccaaattgctatataattgaggtggagcaaaatgag
agaaagcctttacttcagagtgctgttcttggagcgaaagatctgccaagaacaattctc
agcgaccatatagagcagcggttatttagaaggctgaagcaggaaaggactgagagagcc
agggttcaaggaacaagttatgatgagattccaactgctgaatcccttgtggttagagtt
gtttcatctgttgacaagaagttggaagtcaaatctcgatttcttgaaatttttcgggag
gataattttccgacagaatttccatacaagtccaaggtggttctgttgttccagaagata
gaaggtgttgaagtatgcttgtttgggatgtatgtccaagaatttggatccgaatgttca
aatcctaatcaacgccgtatttatctctcgtatttggattctgttaagtactttagacct
gatattaaatctgctaatggagaggctctgcgcactttcgtttaccacgaaattcttatt
ggttacctggaatactgcaaattgcgtggtttcacaagctgctacatatgggcttgtcca
ccactgaagggcgaggattatatcctatattgccatccagaaattcagaaaacaccaaag
tccgataaactacgggaatggtacttagcaatgttgagaaaagctgcaaaggaaggaatt
gttgcggaaactacaaatctatatgaccattttttcttgcaaactggtgaatgtagagct
aaggttacagcagctaggctcccgtacttcgatggtgactactggccaggtgcagcagag
gatatcatataccaaatgagtcaagaagatgatggtagaaagggaaataagaaaggaata
ctcaagaaacccatcacaaaaagggcgcttaaagcatctggccaatcggatctctctggg
aatgcttccaaagatctgctgctaatgcataaacttggtgagaccattcatccaatgaag
gaggatttcatcatggttcacttgcagcattgttgcacgcattgctgttcactgatggta
actggaaatcgttgggtttgcagccaatgcaaagattaccagttatgtgatgggtgttat
gaggctgaacagaaacgagaagacagagaaagacatcctgttaatcacaaagataaacat
aaactttttcctgttgagatcgccgatattccgacggatactaaggacagagatgagata
cttgaaagtgaattttttgatacaaggcaagcattcctgagtctatgtcaagggaaccat
tatcagtatgatacactgaggcgggcaaaacattcttccatgatggtgctttatcatctg
cataatccaactgctcctgcctttgtgacaacatgtaatgcatgtcacctcgatattgaa
agtggtcaaggctggcgctgtgaagtttgcccagactatgatgtgtgcaatgcttgttac
aataaagagggttgtattaatcatcctcataagttaacaaatcatccatctctagctgag
caaaacgctcagaataaagaagctaggcaattgcgggtcttgcagctcaggaaaatgctc
gatcttctggtgcatgcgtcgcaatgccgttctccactttgtcaatatcccaattgccgc
aaagtgaaggggctattccgacatggtctccgctgcaaaatacgtgcctccggaggttgt
gttctatgcaagaaaatgtggtatctcttgcaactccacgctcgggcctgcaaggaatcc
aagtgtgatgtacctcgatgcggggacctaaaggaacatctgagaaggttacaacagcaa
tcagattcaagacgcagagctgccgtcatggagatgatgagacagagagccgcagaagtc
gctggaacctccggttga

DBGET integrated database retrieval system