KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_684058Help
Entry
ARALYDRAFT_684058 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ARALYDRAFT_684058
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ARALYDRAFT_684058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 460 aa AA seqDB search
MIASRVFSSILNSHHRLSFWWFSLLFTVTIAAEETPITRIAFGSCANQSAPQPIWDAINN
FDPQLFIWLGDNIYGDIRRPLTVIGKERTFGPWKNTPRFVPSSEEEMKLRYAKAKANPGY
SRLQRKVKVIGTWDDHDYGLNDAGKEFDRKVTNQKLMLDFLDEPLDSPRRKQAGVYASYT
YGPPNRKVKVIVLDTRYHRDPLRSDGSILGDTQWDWLEKELRGPRSEITIIGSSVQVISN
LSATTGPLFYMESWGRFPKERKRLFQLISDTKRNGVIFISGDVHFGEITRYDCSVGYPLY
DVTSSGLVQSVEKVFPRPLRSIVRLLFWYTPSTMRVINDNCKFKSCTYGQQNFGAISIDW
NANPVIIRLEIRDVNGHTVLGTNVSLSELQPGGSNSLKDATTKGKSQRYCTLEIELPGLI
RYRLAVLIYFTIAVLAMAILGLIIGGVLAITACVYKCKVD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttctagggttttctcttcgattctcaattcccaccaccgcctctccttctgg
tggttttctttgctctttacggtgacgattgctgcagaagagaccccaatcactcgtatt
gccttcggctcatgtgctaaccaaagcgctccacagccaatatgggatgcgataaacaat
tttgatccacaattgttcatttggttgggtgataacatctatggagatattagaagacca
cttacagtcattggtaaagagagaacctttgggccatggaagaatacaccgaggtttgtg
ccttcttcagaggaagaaatgaaattaagatacgctaaagccaaagctaatcctggctat
tctcgtcttcagagaaaggttaaggttattggtacttgggatgatcatgattacggattg
aatgacgccggaaaagagtttgatcgtaaagtcactaaccaaaaattaatgcttgatttc
ttggatgagcctcttgatagcccgaggagaaagcaagctggagtttatgcatcttatact
tatggtccgcctaaccgtaaagtcaaggttatagttttggatactagatatcatagagac
cctttgagaagtgacgggagtatcttgggtgatacgcagtgggactggctcgaaaaagaa
ctgagaggcccgcggagcgaaattactatcattggatcatctgttcaggtgatatcaaat
ctttctgcaaccactggaccactcttttatatggaatcatggggccgttttccgaaggaa
aggaaacgtcttttccaactgatatcagacactaagagaaatggagttatattcatcagt
ggagatgttcatttcggagaaatcacgagatacgattgttctgttgggtacccattatat
gatgtcacctccagtggtctagtacaatctgttgagaaagttttccctcgtcccttgcgt
tccatcgttaggcttcttttttggtatactccaagcacgatgagagttatcaatgataac
tgcaaattcaaatcatgcacatacggacaacaaaattttggagcgatatcgatagattgg
aatgcaaatccggttatcataaggctcgagatcagagatgttaacggacatacagtacta
ggcacaaatgtttcattatccgaactccaaccaggaggctcgaattctttgaaagatgca
acaacaaagggaaagtcccaacgatattgcacactcgaaattgaattaccaggactgatc
agatacagattggcagttctcatctacttcaccattgctgtcttggcaatggcgatatta
ggacttatcattggaggtgtactggccataacagcatgcgtttataaatgcaaggtcgat
tga

DBGET integrated database retrieval system