KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_686104Help
Entry
ARALYDRAFT_686104 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ARALYDRAFT_686104
  Amino acid metabolism
   00340 Histidine metabolism
    ARALYDRAFT_686104
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ARALYDRAFT_686104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 469 aa AA seqDB search
MSINLSRLSLLSSPRISISTHAPHKGYVCCSMKSYRLSELTSSQVDSLKSRPRIDFSSIF
ATVNPIIDAVRSNGDTAIKEYTERFDKVQLNKVVEDMSELSVPELDSNVKEAFDVAYDNI
YAFHLAQKSTEKSVENMKGVRCKRVSRSIGSVGLYVPGGTAVLPSTALMLAIPAQIAGCK
TVVLATPPSKDGSICKEVLYCAKRAGVTHILKAGGAQAIAAMAWGTDSCPKVEKIFGPGN
QYVTAAKMILQNSEAMVSIDMPAGPSEVLVIADEHASPVYIAADLLSQAEHGPDSQVVLV
VVGDGVDLNAIEEEIAKQCKSLPRGEFASKALSHSFTVFARDMIEAISFSNLYAPEHLII
NVKDAEKWEGLIENAGSVFIGPWTPESVGDYASGTNHVLPTYGYARMYSGVSLDSFLKFM
TVQSLTEEGLRNLGPYVATMAEIEGLDAHKRAVTLRLKDIEAKQLAQTN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcaatctgtctcgtctttcgcttctctcgtccccacgtatctcgatttcaact
cacgctcctcacaaaggatacgtttgttgctcgatgaagtcttaccgattatctgaactt
acttcttcccaagttgatagtttgaagtcacgccctcgcattgacttctcttctattttc
gccactgtgaacccgattatcgacgctgttcgtagcaatggggatactgctatcaaagaa
tacactgaaagattcgacaaagtccaactgaacaaagttgtggaagatatgtctgagctt
tctgttcctgagctcgattccaatgtgaaagaagcgtttgatgttgcgtatgacaacata
tatgcatttcacttggcccaaaagtcaactgagaaaagcgttgagaatatgaaaggtgtc
agatgtaaaagggtgtctagatctattggctctgtaggtctttatgtgcctggtggaaca
gctgttttgccatcaactgctttgatgcttgcaattcctgctcaaattgctggatgtaaa
acagttgttcttgcaactccaccaagtaaggatggaagcatatgtaaggaggttctgtat
tgtgccaagagagctggtgtaactcacatactcaaagctggtggagcgcaggctatagct
gccatggcctgggggacagattcttgtccaaaggttgagaagatttttggtcctgggaac
cagtatgttacagctgctaagatgattcttcaaaacagcgaggcaatggtctcaattgat
atgcctgctggtccttcagaagtcctagttattgctgatgaacatgctagtccagtttac
attgcagcagacttactttctcaggctgagcatggtccagatagtcaagttgttcttgtt
gttgtaggcgatggtgtagatctcaacgccatcgaagaagaaattgccaagcagtgcaaa
agccttcctagaggagagtttgcttcaaaagcactaagtcacagtttcacagtgtttgct
cgagatatgattgaggcaatatctttctcaaatctgtatgcaccagaacatttgatcatc
aatgtcaaagacgctgagaaatgggaaggactgattgagaacgcgggctcggttttcata
gggccatggactccagagagtgtcggggattatgcgagcgggacaaaccacgttcttcca
acatatggatatgcaagaatgtacagtggcgtctctctcgactctttcctgaagttcatg
actgtacaatctttgacagaggaaggtctgagaaaccttggtccttatgtggcgacaatg
gctgaaatcgaaggtttagatgcacacaagagagctgtcactctcagactcaaggatatc
gaagctaaacagcttgcccaaacaaattga

DBGET integrated database retrieval system