KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_887292Help
Entry
ARALYDRAFT_887292 CDS       T01578                                 

Definition
mitogen-activated protein kinase 11
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 387 aa AA seqDB search
MSVETTFFGDDSNRGVSINGGRYVQYNVYGNLFEVSQKYVPPLRPIGRGASGIVCAAWNS
ETGEEVAIKKIGNAFGNIIDAKRTLREIKLLKHMDHDNVIAIKDIIRPPQPDNFNDVHIV
YELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDL
KIGDFGLARTKSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTREPL
FPGRDYVQQLRLITEFYEQTQIWFIFFNTQLIGSPDDSSLGFLRSDNARRYVRQLPQYPR
QNFAARFPNMSVNAVDLLQKMLVFDPNRRITVDEALSHPYLAPLHENNEEPVCVSPFRFD
FEQPSLTEENIKELIYRESVKFNPQDS
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtagagacaacattcttcggtgatgacagcaacagaggagtgagtatcaacggt
ggtcgttatgttcagtataatgtctatggaaacctcttcgaagtttctcaaaaatatgtt
cctcctcttcgtcctatcggcagaggcgcttctggcatcgtctgtgctgcatggaattcg
gagacgggtgaggaagtagcgatcaagaagattggtaatgcttttggcaacattatcgac
gctaagagaactttgagagagattaagcttcttaagcatatggatcatgacaatgtcatt
gccattaaagacataataagaccaccgcagccagacaacttcaatgatgttcacattgtc
tatgagttaatggacactgatcttcaccacattatacgctctaaccaaccattaactgat
gatcattcacggttcttcctgtatcagttgttgagaggactcaagtatgtgcattcagct
aatgtattgcatcgtgatttaaaaccaagtaacttgctcctgaatgcaaattgtgacctc
aagattggggattttgggcttgcaaggactaaatcagagacagacttcatgacagaatat
gtcgttacacgttggtaccgagctccagagttactccttaattgctcagaatacactgca
gctatcgatatttggtctgtcggttgtatactcggtgaaataatgaccagagagccgtta
tttccgggcagagattatgttcagcagcttagactcatcactgagttttatgaacaaact
cagatatggttcatatttttcaatacacagcttataggctcaccagatgattcaagccta
ggattcttaagaagcgacaacgctagaagatacgtaagacagcttccacagtatccaaga
caaaactttgccgctagattcccaaacatgtcggttaatgcagttgatttgctgcagaaa
atgctcgtctttgacccaaacagacgcattacagtcgatgaagctttgtcccacccttac
ttagcaccgctacacgaaaataacgaggaacctgtgtgtgtgagtccgttccgttttgat
ttcgagcaaccttcattgacggaagagaacatcaaggagcttatataccgtgaatcagtc
aagtttaaccctcaagattcttag

DBGET integrated database retrieval system