KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_888336Help
Entry
ARALYDRAFT_888336 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aly00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ARALYDRAFT_888336
Enzymes [BR:aly01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     ARALYDRAFT_888336
Peptidases [BR:aly01002]
 Metallo Peptidases
  Family M67
   ARALYDRAFT_888336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 223 aa AA seqDB search
MVTLSSPSPSLSCVENVTCKSSHVSRVLISGTDKNNHGESSEPKILRDVHISERLLEDFT
ELARENTEKDLETCGTLAAFLERGIFYVTTLIIPKQESTSNSCQAMNEVEVFSIQNEREL
YPVGWIHTHPSQGCFMSSVDLHTHYSYQVMVPEAFAIVVAPTDSSKSYGIFKLTDPGGME
VLKGCSETGFHPHKEPEDGNPVYEHCSNVYKNSNLRFEIFDLR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgctctcgtctccatctccgtcgctctcttgcgtagagaacgtgacatgtaaa
tcttctcacgtttctcgggttctaatttccggtaccgataagaataatcacggtgaatca
tcggagcccaagatactgagagatgttcatatctcagaacggttgttggaggatttcact
gagcttgcaagagagaacactgagaaggacctcgagacttgtgggactctcgctgccttt
cttgaaagaggaattttttatgtaaccactctgataatacctaagcaagaatctacttcc
aattcttgtcaggctatgaatgaagtggaagtgttttccattcaaaatgaaagagaactc
tatcccgtaggatggattcatactcatccttctcagggttgtttcatgtcatctgtagat
ttgcatacacattactcgtatcaggtaatggtgccagaggcttttgcaatcgtcgtagct
ccaaccgatagctctaagagttacgggatatttaagctaacggaccctggaggaatggag
gtactgaaaggctgctcagagactggattccacccacacaaagaaccagaagatgggaac
ccagtttatgagcattgctcaaacgtctacaagaactcgaaccttaggttcgagattttt
gatctacgttaa

DBGET integrated database retrieval system