KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_889252Help
Entry
ARALYDRAFT_889252 CDS       T01578                                 

Definition
(RefSeq) hydrolase, alpha/beta fold family protein
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycerolipid metabolism
Metabolic pathways
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ARALYDRAFT_889252
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     ARALYDRAFT_889252
Peptidases [BR:aly01002]
 Serine Peptidases
  Family S33
   ARALYDRAFT_889252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 393 aa AA seqDB search
MICSSKGTVVFATGNSFPRLPIKKSSSGFYVNRIQIRNDLPISIVATRRSSMSVEALPTR
LKSSLKKTRKRNIGCGVSPSSPTTTVVDDEVAVRRNLAMRRVLEDNGGDGSSVRDFSLFT
TKRGDTLFTQSWTPVDSAKNRGLVVLLHGLNEHSGRYSDFAKQLNVNGFKVYGIDWIGHG
GSDGLHAYVASLDYAVADLKTFLEKVIAENPGLPCFCIGHSTGGAIILKAMLDAKIEARV
SGIVLTSPAVGVQPTYPIFGVIAPVLSFLIPRYQLSAAKKKIMPVSRDPEALLAKYSDPL
VYTGFIRARTGHEILRLGAHLLQNLSRIKVPFLVMHGTADTVTDPKGTQKLYNEASSSDK
SIKLYDGLLHDLLFEPERETIAGVILDWLNRRV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatctgttcaagtaaaggaacggtcgtatttgctactggaaactcatttcccagatta
cccatcaaaaaatcttcttccgggttttatgtaaaccggattcaaattcgaaatgatctt
ccgattagtatcgttgctactcgacgatcatcaatgtcggtggaggcgttgccaacgaga
ttaaaatcttcactgaagaagacgaggaagaggaacatcggctgcggtgtttccccttct
tcgccgacaacaacggtggttgatgatgaagtggcggttagacggaatttggcaatgagg
cgggttttggaggataacggtggcgatggaagctccgtcagagatttctcgctattcacg
accaagaggggtgacacgttgttcactcagtcatggacacctgttgactccgctaagaac
aggggacttgttgttctgctacatggtctgaacgaacacagtggcaggtatagtgatttt
gcaaagcagctaaatgttaatggattcaaggtctatggaatagattggatcggtcatggt
ggaagcgatggacttcatgcttacgttgcttctcttgattatgctgtcgctgatttgaaa
acgtttcttgagaaggtaattgcggaaaacccgggattgccctgtttctgcattggccac
tcaactggaggagccataatcttaaaggccatgctagatgcaaagattgaagctcgagtt
tcagggattgtgctaacttcacccgcagttggagtccaaccaacttatcctatcttcggc
gtaattgcaccagttctctcgttcctcataccgagatatcagttaagtgctgcaaaaaag
aaaataatgccggtttctcgtgacccggaagctctattggctaaatactctgacccgcta
gtctacactggatttatccgagcaagaaccggtcacgagatccttagacttggtgctcat
ttactgcagaatctgagcagaatcaaggttccgtttcttgtgatgcacggcacagctgat
acagttactgatcctaaaggtacccaaaagctatacaacgaggcttcctcgtccgataag
tcgatcaagctttacgatgggttgttacacgatctgctctttgaaccagaacgggaaact
atcgctggagtcatattggattggctaaaccggcgggtttaa

DBGET integrated database retrieval system