KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_889795Help
Entry
ARALYDRAFT_889795 CDS       T01578                                 

Gene name
ATCYTC-A
Definition
cytochrome C-1
Orthology
K08738  
cytochrome c
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    ARALYDRAFT_889795 (ATCYTC-A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 114 aa AA seqDB search
MASFDEAPPGNAKAGEKIFRTKCAQCHTVEQGAGHKQGPNLNGLFGRQSGTTAGYSYSAA
NKNKAVDWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQDRADLIAYLKESTGPK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtttgatgaagcaccaccaggaaacgccaaagccggtgagaagatcttcagg
accaagtgtgctcagtgtcacaccgtcgaacaaggcgccggtcacaaacaaggaccaaat
ctaaacggtctctttggaagacaatctggtacaactgctggttactcttactctgctgct
aacaagaacaaagctgtcgactgggaagagaagaccttgtatgattacttgctcaacccc
aagaagtacataccaggtacaaagatggtgttccctgggctaaagaagccgcaagaccgc
gctgatctcattgcgtacttgaaggaatctactgggcctaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system