KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_891254Help
Entry
ARALYDRAFT_891254 CDS       T01578                                 

Definition
(RefSeq) F5J5.19
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase 1 [EC:6.4.1.2 6.3.4.14]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    ARALYDRAFT_891254
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ARALYDRAFT_891254
   00640 Propanoate metabolism
    ARALYDRAFT_891254
  Lipid metabolism
   00061 Fatty acid biosynthesis
    ARALYDRAFT_891254
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    ARALYDRAFT_891254
Enzymes [BR:aly01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ARALYDRAFT_891254
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ARALYDRAFT_891254
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2252 aa AA seqDB search
MAGSVNGYQSAIGPGINYETVSQVDEFCKALGGKRPIHSILIANNGMAAVKFIRSVRTWA
YETFGTEKAILLVGMATPEDMRINAEHIRIADQFVEVPGGTNNNNYANVQLIVEMAEVTR
VDAVWPGWGHASENPELPDALDAKGIIFLGPPAASMAALGDKIGSSLIAQAADVPTLPWS
GSHVKMPPNSNLVTIPEEIYRQACVYTTEEAIASCQVVGYPAMIKASWGGGGKGIRKVHN
DDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKYRNVSALHSRDCSVQRRHQK
IIEEGPITVAPPETVKKLEQAARRLAKSVNYVGAATVEYLYSMDTGEYYFLELNPRLQVE
HPVTEWIAEINLPAAQVAVGMGVPLWQIPEIRRFYGIEHGGGYDSWRKTSVVAFPFDFDK
AESIRPKGHCVAVRVTSEDPDDGFKPTSGRVQELSFKSKPNVWAYFSVKSGGGIHEFSDS
QFGHVFAFGESRALAIANMVLGLKEIQIRGEIRTNVDYTIDLLHASDYRENKIHTGWLDS
RIAMRVRAERPPWYLSVVGGALYKASATSAAVVSDYVGYLEKGQIPPKHISLVHSQVSLN
IEGSKYTIDVVRGGSGTYRLRMNNSEVVAEIHTLRDGGLLMQLDGKSHVIYAEEEAAGTR
LLIDGRTCLLQNDHDPSKLMAETPCKLLRYLVADNNKIDADTPYAEVEVMKMCMPLLSPA
SGVIHFKMSEGQAMQAGELIAKLDLDDPSAVRKAEPFHGGFPRLGLPTAISGKVHQRCAA
TLNAARMILAGYEHKVDEVVQDLLNCLDSPELPFLQWQECFAVLATRLPKNLRNMLESKY
REFENISRNSLTTDFPAKLLRGILEAHVSSCDEKERGALERLIEPLMSLAKSYEGGRESH
ARVIVHSLFEEYLSVEELFNDNMLADVIERMRQQYKKDLLKIVDIVLSHQGIKNKNKLVL
RLMEQLVYPNPAAYRDKLIRFSTLNHTNYSELALKASQLLEQTKLSELRSNIARSLSELE
MFTEDGENMDTPKRKSAINERIEDLVSASLAVEDALVGLFDHSDHTLQRRVVETYIRRLY
QPYVVKESVRMQWHRSGLIASWEFLEEHMENIGLDYHDTSEKGSVEKRSKRKWGAMVIIK
SLQFLPSIISAALRETNHNDYETAGALLSGNMMHIAIVGINNQMSLLQDSGDEDQAQERV
NKLAKILKEEEVSSSLCAAGVGVISCIIQRDEGRTPMRHSFHWSMEKQYYVEEPLLRHLE
PPLSIYLELDKLKGYSNIQYTPSRDRQWHLYTVTDKPVPIKRMFLRSLVRQATMNDGFML
QQGQDKQLSQTLFSMPFTSKCVLRSLMDAMEELELNAHNAAMKPDHAHMFLCILREQQID
DLVPYPRRVEVNAEDEETSVEMILEEAAREIHRSVGVRMHRLGVCEWEVRLWLVSSGLAC
GAWRVVVANVTGRTCTVHIYREVETPGRSTLIYHSITKKGPLHGTPISDQYKPLGYLDRQ
RLAARRSNTTYCYDFPLAFETALELLWASQHPGVKKPYKNTMINVKELVFSKAEGSPGTS
LNLVERPLGLNEFGMVAWCLDMSTPEFPMGRKLLVVANDVTFKAGSFGPREDAFFLAVTE
LACAKKLPLIYLAANSGARLGVAEEVKACFKVGWSDEVSPENGFQYIYLSPEDHEKIGSS
VIAHEVKLPSGETRWVIDTIVGKEDGIGVENLTGSGAIAGAYSRAYNETFTLTFVSGRTV
GIGAYLARLGMRCIQRLDQPIILTGFSTLNKLLGREVYSSHMQLGGPKIMGTNGVVHLTV
SDDLDGVSAILNWLSYIPAYVGGPLPVLAPLDPPERTVEYVPENSCDPRAAIAGVNDNTG
KWLGGIFDKNSFIETLEGWARTVVTGRAKLGGIPVGVVAVETQTVMQIIPADPGQLDSHE
RVVPQAGQVWFPDSAAKTAQALMDFNREELPLFILANWRGFSGGQRDLFEGILQAGSTIV
ENLRTYRQPVFVYIPMMGELRGGAWVVVDSQINSDYVEMYADETARGNVLEPEGTIEIKF
RTKELLECMGRLDQKLIGLKAKLQDAKQSEAYANIELLQQQIKAREKQLLPVYIQIATKF
AELHDTSMRMAAKGVIKSVVEWSGSRSFFYKKLNRRIAESSLVKNVREASGDNLSYKSAM
GLIQDWFCNSDIAKGKEEAWTDDQVFFTWKDNVSNYELKLSELRAQKLLNQLAEIGNSSD
LQALPQGLANLLNKVEPSKREELVNAIRKVLG
NT seq 6759 nt NT seq  +upstreamnt  +downstreamnt
atggctggctcggttaacgggtatcagagtgctatcggacctggtataaattatgagacg
gtgtctcaagttgatgagttctgtaaagcacttggaggaaaaaggccgatccatagtatt
ttgatcgctaacaatggaatggcggctgtcaagtttatacgtagtgtcagaacgtgggct
tacgaaacatttggtacggaaaaagccatattgttggtggggatggcgacccctgaagac
atgcggatcaatgcggagcatatcagaatcgctgatcagtttgttgaggttccgggagga
accaacaataacaattatgctaacgttcagcttattgtggagatggctgaagtaacacgc
gtggatgcagtttggcctggttggggtcatgcatctgaaaatcctgaattacctgatgcc
ctagatgcaaaaggaataatatttcttggtcctccggcagcttcaatggcagcactagga
gataagattggttcttcgttgattgcacaagctgctgatgtacccactctgccatggagt
ggttcccatgttaaaatgcctcctaatagcaacctggtaaccatccccgaggagatctac
cgacaagcatgtgtctacacaactgaagaagcgattgctagctgtcaagttgtcggttac
ccagcaatgatcaaagcatcgtggggaggtggcggtaaaggcattaggaaggttcataat
gatgatgaggttagggctctattcaagcaagttcagggtgaggtcccaggctcaccgata
ttcataatgaaggttgcgtcacagagtcggcatttagaggtccagctgctctgtgacaaa
tatcgaaatgtttcagctctgcatagccgtgattgtagcgtccagagaagacatcaaaag
atcatagaggagggtccaattactgtggctccgccagaaactgtcaagaaacttgagcaa
gcagctagaaggttggctaagagtgttaactatgttggagctgctactgttgagtatctc
tacagtatggacactggggagtactacttcttagagcttaaccctcgcttacaggttgag
caccctgtaactgagtggattgctgagataaatcttcctgctgcccaagttgctgtgggg
atgggagttcctctctggcaaatccctgagataagacggttctatggtatagaacatggt
ggaggttatgattcttggagaaaaacatctgttgtagccttcccttttgattttgataaa
gctgaaagtataaggccaaaaggtcattgtgtggctgtacgtgtgacaagcgaggatcct
gatgatgggttcaaaccaaccagcggtagagttcaggaattgagttttaagagcaagcca
aatgtgtgggcgtacttctctgtcaagtctggtggaggcatccacgagttctcggattcc
cagtttggacatgtttttgcatttggggaatccagagccttggcgatagcgaatatggtt
cttgggctaaaagaaattcaaatccgtggagaaattaggactaacgtggactacacgatc
gaccttttacatgcttctgattaccgagaaaacaaaattcacactggttggttggacagt
aggattgctatgcgggtcagagctgagaggcctccatggtatctctcagttgtcggtggg
gccctctataaagcatcagcgaccagtgctgctgtggtttcagattacgttggttatctg
gagaaggggcaaattccaccaaagcatatatctcttgtgcattctcaagtgtctctgaat
attgaaggaagtaaatatacgattgatgtagtccggggtggatcaggaacctacaggcta
agaatgaacaactcagaagttgtagcagaaatacacactctacgggatggaggtcttctg
atgcagttggatggtaaaagccatgtgatatatgcagaggaagaagctgcaggaactcgt
cttctcattgatggaagaacttgtttgctacagaatgaccacgatccttcgaagttgatg
gcggagacaccgtgcaagttgctcaggtatttggttgcagacaacaacaaaattgacgct
gatacgccttatgccgaagttgaggtcatgaagatgtgcatgccacttctttcacctgct
tcaggagttatccatttcaaaatgtctgaaggacaagccatgcaggctggtgaacttata
gccaagcttgatcttgatgatccttctgctgtaagaaaggccgaacccttccatggaggt
ttcccaagattagggcttccaactgcaatatctggtaaagttcatcagagatgtgctgca
actttaaatgctgctcgcatgattcttgccggctatgagcataaagtagatgaggttgtt
caagacttacttaattgcctggatagccctgaactgccatttcttcagtggcaagagtgc
tttgcagttctggcgacacgactacctaaaaatctcaggaacatgctcgaatcaaagtat
agggaatttgagaatatctccagaaactctctgaccaccgatttccctgccaaactctta
agaggcattcttgaggcacatgtatcttcttgtgatgagaaagagagaggtgccctggaa
aggctcattgaaccgttgatgagccttgcaaaatcttatgaaggtggtagagaaagtcat
gcgcgtgttattgttcattctctctttgaagaatatctatcagtagaagaattattcaat
gataacatgctggctgatgttatagaacgcatgcgtcagcaatacaagaaagatctgttg
aagattgtggatatagtactctcacaccagggcattaaaaacaaaaataaactcgttcta
cggctcatggagcagctagtttaccctaatcctgctgcttacagagataaacttatccga
ttctccacacttaaccatactaactactctgagttggcgctcaaggcgagtcaattgctt
gaacagaccaaactaagtgaacttcgttcaaacattgctagaagcctttcagagttagaa
atgtttacagaggatggagaaaatatggatactcccaagaggaaaagtgccattaatgaa
agaatagaagatcttgtgagcgcgtctttagctgttgaagatgctctcgtgggactattt
gaccacagcgatcacacacttcaaagacgggttgttgagacttatattcgcagattatac
cagccctatgtcgttaaagaaagcgtgagaatgcagtggcaccgttctggtcttattgct
tcctgggagttcctagaggagcatatggaaaacattggcttagactatcacgacacatct
gaaaaaggatcggttgagaagcgtagtaagagaaaatggggggctatggttataatcaaa
tcgctgcagtttctgccaagtataataagtgcagcattgagagaaacaaaccacaacgac
tatgaaactgccggagctcttttatctggcaatatgatgcacattgctattgtgggcatc
aacaaccagatgagtctgcttcaggacagtggggatgaagaccaagctcaggaaagagta
aacaagctggccaaaattcttaaagaggaagaagtgagttcgagcctctgtgctgccggt
gttggtgtaatcagctgtataattcagcgagatgaaggacgaacacccatgagacattct
ttccattggtcgatggagaaacagtattatgtagaagagccgttgctgcgtcatcttgaa
cctcctctgtccatataccttgagttggataagctgaaaggatactcaaatatacaatat
acgccttcacgagatcgtcaatggcatttgtatactgttacagacaagccagtgccaatc
aagaggatgttcctgagatctcttgttcgacaggctacaatgaacgatggctttatgttg
cagcaagggcaggataagcagcttagtcaaacactgttctccatgccgtttacgtcgaaa
tgcgttctgaggtctttgatggatgccatggaggaactagaactaaatgcccataatgct
gcaatgaaaccagaccacgcacatatgtttctttgcatattgcgtgagcagcagatagat
gatcttgtgccttaccccaggagagttgaagtgaatgcggaggatgaagaaacatcagtt
gagatgatcttagaagaagcagcacgagagatacatagatctgtcggagtgagaatgcat
aggttgggcgtgtgcgagtgggaagtgcggctttggttggtgtcctctggattggcatgt
ggcgcttggagggttgtggttgcaaatgtgacaggccgtacatgcactgtccacatatac
cgagaagttgaaactcctgggagaagtactttaatttaccactcaataaccaagaaggga
cctttgcatggaaccccaataagtgatcaatataaacccctgggatatctcgacaggcaa
cgtctagcggcaaggaggagtaacactacttattgctatgacttcccgttggcatttgag
acagccttggaattgttgtgggcatcacaacacccgggagttaagaaaccatataagaat
actatgattaatgttaaagagcttgtgttctccaaagcagaaggttctccaggtacatct
ctaaatctggttgaaagaccactgggtctcaacgaatttggaatggttgcctggtgccta
gatatgtcgacccctgagtttcctatgggacggaaacttctcgtagtcgctaatgatgtt
accttcaaagctggttcttttggtcctagagaggacgcttttttcctcgctgttaccgaa
ctcgcttgtgcaaagaagcttcccttgatttacttggcagcaaattctggtgcccgactc
ggagttgctgaagaagtcaaagcctgcttcaaagttggatggtcggatgaagtttcccct
gagaacggttttcagtacatatacctaagccctgaagaccatgaaaagattggatcatct
gtcattgcgcacgaagtgaagctgcctagtggggaaacaagatgggtgattgatactata
gttggtaaagaagatggtattggtgtagagaacttaacaggaagtggggcaatagcgggt
gcttactcaagggcatacaacgaaacttttactttaacctttgttagtgggagaacggtt
ggaattggtgcttatcttgcccgcctgggtatgcggtgcatacagagacttgaccagccg
attattttgactggcttttctacactcaacaagttacttgggcgtgaggtctatagctct
cacatgcaacttggtggcccgaaaatcatgggcacaaatggtgttgttcatcttacagtc
tcagatgatcttgatggcgtatcagcaattctcaactggctgagttacattcctgcttac
gtgggtggtcctcttcctgttcttgcccctttagatccaccggagagaactgtggagtac
gtccccgagaactcttgtgacccacgagcggctatagctggggtcaacgacaataccggt
aaatggcttggaggtatttttgataaaaatagctttattgagactcttgaaggctgggct
aggacggtagtgactggtagagctaagctcggggggatacccgttggagttgttgctgtt
gagacacagactgtaatgcagatcatcccagccgatcctggacagcttgactctcatgaa
agagtggttccgcaagcagggcaagtctggtttcctgattcagcggccaagacagctcaa
gcgctcatggatttcaaccgggaagagcttccgctgtttatcctagcgaactggagaggg
ttttcaggtgggcagagagatcttttcgaaggaatacttcaggcgggttcaactatagta
gaaaatctgagaacatatcggcagccagtgtttgtgtacatcccaatgatgggagagctg
cgcggtggagcgtgggttgttgttgacagccagataaattcagattatgttgaaatgtat
gctgatgaaactgctcgtggaaatgttctcgagccagaagggacgatagagataaaattt
agaacaaaagagctgttagagtgcatgggaaggttggaccagaagctaatcggtctcaaa
gcaaaattgcaagatgccaagcaaagcgaggcctatgcaaacatcgagcttctccagcaa
cagattaaagcccgagagaaacagcttttaccagtttatatccaaatcgccaccaaattt
gcggaacttcatgacacttccatgagaatggctgcaaaaggagtgatcaaaagtgttgtg
gaatggagtggctctcggtccttcttctataaaaagctaaataggagaattgctgagagc
tctcttgtgaaaaacgtaagagaagcgtctggagacaacttatcatataaatctgcaatg
ggtttgattcaggattggttctgtaactctgatattgcaaaggggaaagaagaagcttgg
acagacgaccaagtgttttttacatggaaggacaacgttagtaactacgagttaaagctg
agcgagttgagagcgcagaaactactgaatcaacttgcagagattgggaattcgtcagat
ctgcaagctctacctcagggacttgctaatcttctaaacaaggtggagccttcaaaaaga
gaagaactggtgaatgccattcgaaaggtgttgggttga

DBGET integrated database retrieval system