KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_894873Help
Entry
ARALYDRAFT_894873 CDS       T01578                                 

Gene name
AOAT2
Definition
(RefSeq) alanine-2-oxoglutarate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00220  Arginine biosynthesis
aly00250  Alanine, aspartate and glutamate metabolism
aly00260  Glycine, serine and threonine metabolism
aly00630  Glyoxylate and dicarboxylate metabolism
aly00710  Carbon fixation in photosynthetic organisms
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
aly01210  2-Oxocarboxylic acid metabolism
aly01230  Biosynthesis of amino acids
Module
aly_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
aly_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ARALYDRAFT_894873 (AOAT2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_894873 (AOAT2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARALYDRAFT_894873 (AOAT2)
   00260 Glycine, serine and threonine metabolism
    ARALYDRAFT_894873 (AOAT2)
   00220 Arginine biosynthesis
    ARALYDRAFT_894873 (AOAT2)
Enzymes [BR:aly01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ARALYDRAFT_894873 (AOAT2)
    2.6.1.4  glycine transaminase
     ARALYDRAFT_894873 (AOAT2)
    2.6.1.44  alanine---glyoxylate transaminase
     ARALYDRAFT_894873 (AOAT2)
Amino acid related enzymes [BR:aly01007]
 Aminotransferase (transaminase)
  Class I
   ARALYDRAFT_894873 (AOAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 9323376
NCBI-ProteinID: XP_002887312
UniProt: D7KY45
Position
Unknown
AA seq 482 aa AA seqDB search
MSLKALDYESLNENVKNCQYAVRGELYLRASELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNIGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFI
ERRDGYPSDPELIFLTDGASKGVMQILNCVIRSQKDGILVPVPQYPLYSATISLLGGTLV
PYYLEESENWGLDVNNLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANLKEILRFCC
DERLVLLGDEVYQQNIYQDERPFISSKKVLMDMGAPISKEVQLISFHTVSKGYWGECGQR
GGYFEMTNIPPRTVEEIYKVASIALSPNVSAQIFMGLMVSPPKPGDISHDQFVCESKRIL
ESLRRRARMMTDGFNSCKNVVCNFTEGAMYSFPQIKLPSKAIEAAKQAGKVPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPEIMDSFKKFNDEFMSQYGDNNFGYS
RM
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcaaggcattagactacgagtccctgaatgaaaacgtcaagaattgtcagtat
gcagtcagaggtgaactctatctccgtgcttctgagcttcagaaagaaggcaaaaagatt
attttcacaaatgttggaaaccctcatgctttaggacagaagcctctgacttttcctcgt
caggtggttgctttatgccaagcaccatttctgctagatgacccaaatattggtatgata
ttcccagcagatgctattgcaagagctaagcattatctatctttgacttctggtggtctt
ggtgcttacagtgactcaagaggcctcccgggagttcggaaagaagtcgctgagttcatt
gaacggcgtgatggatatccaagcgacccagaacttatatttctaactgatggagctagc
aaaggtgtgatgcaaatcttgaattgtgtcatacgcagtcagaaagacggaattctggtt
ccagtaccgcagtatcctctctactcggctactatatctctgttaggtggtactcttgtt
ccttactatcttgaagagtctgaaaactggggacttgatgttaacaaccttcgccaatct
gttgctcaggctcgctctcaaggaataacagtaagggcaatggtgatcattaaccctggg
aacccaactggccagtgtcttagcgaagctaacttaaaagagatattacggttctgttgt
gatgagagattggttcttcttggagatgaagtgtatcagcaaaacatataccaagatgag
cgtccctttatcagttccaaaaaggttttgatggatatgggagcaccgatcagcaaggaa
gttcagcttatatctttccacaccgtttccaaaggatactggggcgagtgtgggcaacga
ggcggttactttgagatgacaaatatccctcccaggactgttgaggagatatacaaggtt
gcctctatagctctcagtcccaacgtctctgcacagatatttatgggtttaatggttagc
ccaccaaagcctggagacatatctcatgaccaattcgtttgtgaaagcaagcgaatacta
gaatcactgagaagaagagcaaggatgatgactgatggattcaacagctgcaaaaacgtc
gtctgtaatttcacagaaggggctatgtattcattccctcaaataaagttaccgtcgaaa
gcaatcgaagcagcaaaacaagccggaaaagtccctgacgttttctactgccttaagctc
ttagaagccacaggaatctccacagttccaggctctggatttggacaaaaagaaggggtg
tttcatttaaggacaacaattctgcctgcagaagaagaaatgccagagattatggacagt
ttcaaaaagttcaatgatgagttcatgtctcagtacggtgataataactttggttactcc
agaatgtga

DBGET integrated database retrieval system