KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_896779Help
Entry
ARALYDRAFT_896779 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     ARALYDRAFT_896779
Protein kinases [BR:aly01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   ARALYDRAFT_896779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 366 aa AA seqDB search
MAVKKACEMFPKSLIEDVHKWGCMKQTGVSLRYMMEFGSKPTERNLLISAQFLHKELPIR
VARRAIELQTLPYGLSEKPAVLKVRDWYLESFRDMRAFPEIKDSGDEKEFTQMIKAVKVR
HNNVVPMMALGVNQLKKGMNSGNLDEIHQFLDRFYLSRIGIRMLIGQHVELHNPNPPLHT
VGYIHTKMSPMEVARNASEDARSICFREYGSAPEINIYGDPSFTFPYVPTHLHLMMYELV
KNSLRAVQERFVDSDRVAPPIRIIVADGIEDVTIKVSDEGGGIARSGLPKIFTYLYSTAR
NPLEEEVDLGTADVPVTMAGYGYGLPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGD
SQEPLP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgaagaaggcctgcgaaatgttcccgaagagtttgatcgaagatgttcacaaa
tggggttgcatgaagcaaacaggtgttagccttagatacatgatggagtttggttccaaa
cctactgagaggaatcttttgatttctgctcagtttctgcataaggagcttccgattcgc
gtcgccaggagagcgatcgaactccagacgcttccttatggtctctctgagaaacctgcc
gttttgaaggtgcgagattggtatttggaatctttcagggacatgagagcatttcctgag
attaaggattcgggtgacgagaaagaattcactcagatgattaaggctgttaaggtaagg
cacaacaatgtggttcccatgatggctttaggtgttaatcagctcaagaaaggaatgaat
tccggaaatcttgatgagattcatcagtttcttgatcgcttctacttgtcccgaataggg
atccgtatgcttattgggcagcatgttgagttgcataatccaaatccaccacttcataca
gtgggttatatacacacaaagatgtctcctatggaggtagcaaggaatgccagtgaagat
gctcgctcaatttgtttccgagagtatggttctgcaccggaaataaacatatatggcgat
cccagtttcacctttccgtatgttccaacgcatttgcatcttatgatgtatgagctagtc
aagaactctctacgtgctgtccaagagcgatttgttgactctgatagagttgcaccacca
atccgcattatagttgcagatggaattgaagatgttacaataaaggtctcagatgaaggt
ggaggtatagcgagaagcggtcttcccaaaatattcacctatctttacagcactgcaaga
aacccgcttgaggaggaagtcgatttaggaacagctgatgttccggtgactatggctggg
tatggttacggtcttccaattagtcgcttgtatgctcgatatttcggtggagatttgcag
atcatatccatggaaggatatgggactgatgcttacttgcacttgtctcgccttggagat
tcgcaagagcctttaccctga

DBGET integrated database retrieval system