KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_896987Help
Entry
ARALYDRAFT_896987 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aly00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ARALYDRAFT_896987
Exosome [BR:aly04147]
 Exosomal proteins
  Proteins found in most exosomes
   ARALYDRAFT_896987
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1703 aa AA seqDB search
MAAANAPITMKEVLTLPSVGINQQFITFTNVTMESDKYICVRETSPQNSVVIIDMNMPMQ
PLRRPITADSALMNPNSRILALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVVFWKWI
TPKMLGLVTQNSVYHWSIEGDSEPVKMFDRTANLTNNQIINYKCSPNEKWLVLIGIAPGS
PERQQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVPGNENPSILISFASKSFNAGQITS
KLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGLLFVYDL
ETASAIYRNRISPDPIFLTSEASSVGGFYAINRRGQVLLATVNEATIIPFISGQLNNLEL
AVNLAKRGNLPGAENLVVQRFQELFAQTKYKEAAELAAESPQGILRTPDTVAKFQSVPVQ
AGQTPPLLQYFGTLLTRGKLNSYESLELSRLVVNQNKKNLLENWLAEDKLECSEELGDLV
KTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTILRTDPQ
GAVNFALMMSQMEGGSPVDYNTITDLFLQRNLIREATSFLLDVLKPNLPEHAFLQTKVLE
INLVTFPNVADAVLANGMFTHYDRPRIAQLCEKAGLYIQSLKHYSELPDIKRVIVNTHAI
EPQALVEFFGTLSSEWAMECMKDLLLVNLRGNLQIIVQACKEYCEQLGVDACIKLFEQFK
SYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTKNFLMEA
KLPDARPLINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPE
DFIKGLILSVRSLLPVEPLVEECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDS
NNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVAYRRGQCDEELINVTNKNSLFKLQARY
VVERMDGDLWDKVLDENNDYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIE
LLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYE
EAFAIFKKFNLNVQAVNVLLDNVRSIERAVEFAFRVEEDSVWSQVAKAQLREGLVSDAIE
SFIRADDATHFLEVIRVSEDTDVYDDLVKYLLMVRQKVKEPKVDSELIYAYAKIDRLGEI
EEFILMPNVANLQNVGDRLYDEALYEAAKIIYAFISNWGKLAVTLVKLQQFQGAVDAARK
ANSAKTWKEVCFACVDAEEFRLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLMESG
LGLERAHMGIFTELGVLYARYRYEKLMEHIKLFSTRLNIPKLIRACDEQQHWQELTYLYI
QYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVANVELYYKAVHFYLQEHPDLINDLLNVL
ALRLDHTRVVDIMRKAGHLRLIKPYMIAVQSNNVSAVNEALNEIYVEEEDYDRLRESIDL
HDSFDQIGLAQKIEKHELVEMRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGE
HELAEQLLVYFIEQGKKECFATCLFVCYDLIRPDVALELAWINNMMDFAFPYLLQFIREY
SGKVDELIKDKLEAQKEVKAKEQEEKDVMSQQNMYAQLLPLALPAPPMPGMGGGGGYGPP
PQMGGMPGMPPMPPYGMPPMGGY
NT seq 5112 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgccaacgcccccatcacgatgaaggaggtcctgacgcttcctagcgtcggg
atcaatcagcaattcatcacgtttacaaatgttactatggagtctgacaagtacatctgt
gtacgagagacgtcaccgcaaaacagtgttgtaattatagatatgaatatgccgatgcag
cctctaaggagacctattaccgcagattctgctcttatgaacccaaactcgaggatcctt
gccttaaaagctcaagttccaggaaccactcaggatcatctacagatatttaacattgaa
gcaaaagcaaagttaaaatcacatcagatgcctgagcaggttgtcttttggaagtggatt
acaccaaagatgttggggctggtcacacagaattccgtctatcattggtcaattgaaggc
gattctgagccagttaagatgtttgatagaacagccaatttgaccaacaatcaaattata
aactataagtgctctcctaatgagaagtggttggttttaattggaattgctcctggctct
cctgagagacaacaattggttaaaggaaatatgcagcttttctctgtggatcaacagcgg
agtcaggcccttgaggcacatgctgcatcatttgcgcagtttaaggtccctgggaatgag
aatccttctattcttatatcatttgcaagcaagagctttaatgctgggcagataacatca
aagttgcatgtcattgaacttggtgcccaacctggaaaaccatcatttacaaaaaagcaa
gcagatctctttttcccacctgattttgctgatgattttcctgttgccatgcaggtctct
cacaaatttaacttgatatatgttatcaccaaacttggcctattgtttgtgtacgatcta
gagactgcttctgctatctacagaaatcggattagtccagacccaattttcttgacttct
gaagcttcctcagttgggggtttctatgccattaataggcgaggacaagttcttttggct
acagtaaacgaggctaccattataccttttattagtggccaattgaacaatttggagctt
gctgtcaatcttgctaaaagaggaaacctcccaggtgcagaaaatctggttgtccagcgg
ttccaggagttgttcgctcaaacaaagtacaaggaggctgctgagcttgctgctgaatct
cctcaaggaattctaaggacacctgatacagtggccaaattccagagtgttcctgtacaa
gctgggcaaactcctccattgttacagtattttgggactcttttgactagagggaagctc
aattcatatgagtcactggaactatctcggctggttgtgaaccaaaacaagaagaacctc
ctggaaaactggttggcagaggataagctagaatgcagtgaagaacttggagaccttgtc
aagactgttgataatgatcttgctctgaaaatatacatcaaagctcgggcgactccaaaa
gttgtagcagcttttgcagaaagaagggagtttgacaaaatattgatttactcaaagcag
gttgggtacacacctgattacctgtttcttctgcaaaccatactccgtacagatcctcag
ggagcagtaaattttgcattaatgatgtctcaaatggaaggaggttctccagttgactac
aacaccatcactgatctttttcttcagagaaatctgatccgtgaagcgacttctttcctt
ctggatgtgctaaagccaaatttacctgagcatgcttttctgcaaactaaggttctggag
atcaatttggtaacttttcctaatgtggctgatgcggtattagcaaatggaatgttcact
cactatgaccggcctcgtattgctcaactttgtgaaaaggctggactttatatccaatcc
ttgaagcattactcagagttgcctgatataaaacgtgtaattgtaaacacacatgctatc
gagccacaggctcttgttgagttttttggcactctttctagcgagtgggctatggagtgc
atgaaggatctgttgctggtcaacctgagaggcaatctgcagataattgttcaggcttgc
aaggagtactgtgagcaacttggtgttgatgcatgtattaagctctttgagcagttcaag
tcatacgaagggctatactttttcctaggttcatatttgagtatgagtgaggatcctgag
attcacttcaaatacattgaagcagctgccaagactggtcaaataaaggaggttgagcgt
gtaactagagagtctaacttctatgatgctgaaaagacgaagaactttttgatggaagct
aagctgcctgatgcacgacctttgataaatgtctgcgatcgttttggctttgtgcctgat
cttactcattacctctacacaaacaacatgcttcgttacattgaaggttacgtacagaag
gtgaaccctgggaatgctcccttagttgttgggcagttgcttgatgatgaatgccccgaa
gattttataaaaggcctcattctctctgttcgttcattgcttcctgttgaaccacttgtc
gaggaatgtgagaagagaaatcgactccgtctcctcactcagttcttggagcatttagtt
agtgagggaagccaggatgtgcatgtccataatgccttgggtaaaattatcatagacagt
aacaacaaccctgagcatttcctgaccaccaacccttactacgactctaaggtcgtgggt
aagtactgcgagaaacgtgatcctaccctggcggttgtggcatacagaagaggacaatgt
gatgaggaactcatcaatgtcactaacaaaaactctttgttcaagttacaagccaggtat
gtagtggagaggatggatggtgatctctgggataaggttctcgatgaaaacaatgattat
agaagacagcttattgaccaagttgtttctactgctttacctgaaagcaagagcccggag
caagtttctgcagctgttaaagcattcatgactgctgatttgccgcacgagcttattgag
cttcttgaaaagattgttcttcaaaattctgccttcagtggaaacttcaatctgcaaaat
ctgcttatattgacagctattaaggcagatccatctagagttatggattacattaacagg
ctggacaactttgatggacctgcggttggagaagtcgcagttgaagcccaattgtatgag
gaagcatttgctatcttcaagaagttcaacttaaatgttcaggctgtcaatgtattgctg
gataacgtcagaagcattgagcgtgcagttgagtttgcattccgggtcgaagaagattct
gtttggagccaagttgctaaggcgcaactcagagaaggactagtcagtgatgcaattgag
tcctttatccgtgctgatgatgccactcatttcttggaagtcatacgtgtctctgaagat
actgatgtctatgatgacttggtcaaataccttctgatggttagacagaaggtgaaggaa
cccaaggttgatagtgagcttatctatgcatatgcaaagattgataggttaggtgagatt
gaagaattcattctgatgccaaacgttgctaatctacaaaatgttggtgatcgtctgtat
gacgaagctctgtatgaggctgcaaaaataatatatgcgttcatatcaaactggggcaag
ttagccgtcacacttgtgaagttgcaacagttccaaggtgctgttgatgctgcaaggaaa
gcaaacagtgcaaagacatggaaggaagtctgctttgcttgcgttgatgcagaggaattc
cggttggctcaaatctgtggtcttaacattatcattcaggtggatgacctggaagaagtc
agcgagtactaccagaacagagggtgcttcaatgaattaatctcacttatggagagtgga
cttgggcttgaacgtgctcacatgggtatcttcaccgagttgggtgtactctatgctaga
tatcgttatgagaaacttatggaacacatcaagttattttcaactcgcctcaatattccc
aagcttatacgggcctgtgatgaacaacagcactggcaggaacttacctatctgtacatt
caatatgatgagtttgataatgctgcgaccaccgtcatgaaccattctcctgaagcatgg
gagcacatgcaattcaaagacattgttgccaaggtagcgaatgttgaactgtactacaag
gctgtgcacttctacttgcaagagcatcctgatctaatcaacgatcttctcaacgtgctt
gcgttgcggttagaccatactcgtgttgttgatataatgcggaaggctggtcacttacgt
cttatcaagccatacatgattgcagttcagagcaacaatgtctctgccgttaatgaggct
ctgaatgagatatacgtggaagaagaagactatgataggttgcgagagtctattgattta
catgacagctttgaccagattggcctcgctcagaagatcgagaaacacgagcttgttgaa
atgagacgtgtggctgcttatatctacaagaaagcgggcagatggaagcaatcaattgca
ttatcaaagaaagacaacatgtacaaggactgtatggaaactgcttcacaatccggcgaa
catgaacttgcagaacaactactggtgtacttcattgaacaggggaaaaaggaatgcttt
gctacatgtctgtttgtatgttatgacttaatccgaccagacgtggctcttgaacttgca
tggatcaacaatatgatggactttgccttcccgtatctcctccagtttatccgagaatac
tctggcaaagtggatgagttaataaaggacaagctggaggcacaaaaagaggtgaaggct
aaagagcaggaagagaaggatgttatgtcccaacagaacatgtacgcccaactattgcca
cttgctttacctgcaccaccgatgccaggaatgggaggtggtggtgggtatggcccgcca
ccacaaatgggcggtatgccaggaatgcctcccatgccaccatatggaatgccaccaatg
ggtggctactaa

DBGET integrated database retrieval system