KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_897509Help
Entry
ARALYDRAFT_897509 CDS       T01578                                 

Definition
histone acetyltransferase 5
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1657 aa AA seqDB search
MAQGQNRTVLQPGQMQNSVAASASSVSSQPNMVNGISRDNLLLRQDMLNRIYAWLQQRQP
SKTDDASKAKLIEVAKRLESAMLRTAKSKEDYLDFRSFDVRIESNLKQLLSQRRANPSSS
VSTMVQTPAVSHGWNQSYTATPMVDTSTFNSSNNLSDATIETGRLLQTNHMNRGSINNGR
QQLSTVGQMIPTPGFDNIANADVYQSHRNEEYSGDGGKLLAAGSDIGNPSQLQKQRPTGS
NDRMLYNLDHQLGGGFRSNIHQNTSGMTNIPLNAGVGMSGNNVNLANGPRSSEGVLSSTH
YSTLSQPLQQPVDQLQVSHVNRYSMSNSGTFGSGNLYGGVTSSGSMETAVDMNSMSQNSM
RRVDASFGSQSSLQNNPLLKPQLHHQFENGNFQSSSSSKENLAQVSRRPLERQFNQQAHH
GQYQQQELLLNNDGYRRSQLASNLVSQVKNEPRVEYYNEAFQMQAINKGEPSKPQNQYKQ
NAVKDEYVGAQSAPVSSSELKMSPSFPPQTHQAQQVSQWKDSSNLSAGVQPVSGLGQWHS
SSQNLTPILKSSNEEREHFGVRFHMQHEGTNNSSSVRESTNCQTVAPRGTLEVPHLPVGN
NALSKQLNGDCGLSYKNQRRWLLFLLHVRKCNAAEDNCESKYCFTAKTLLKHINYCKASA
CAYQYCRQTRQLIHHYKHCGNEACPVCVFVKNFKEKQKEKFTFLKRAEPSSASLKHGPKE
SFESMRTSSEKDSEAPFVVDDLQPSPKRQKVEKPSQFAYPDTQGIPVAISAGVSQAHFSM
GLQEKDRLQSDVCKPVRSNVPMNAGSSDSSRRLVPASRELEKPVYKDGETVRLSKQEKPK
RMTEISAPKEENAEQSLGIVSASNSGKSKIKGVSLIELFTPEQVEEHIRGLRQWVGQSKT
KAEKNKAMGLSMSENSCQLCAVERLAFEPTPIYCTPCGARVKRNAMHYTVVAGESRHYVC
IPCYNEARANTVSVDGASVPKSRFEKKKNDEEVEESWVQCDKCQAWQHQICALFNGRRNH
GQAEYTCPNCYIQEVEQGERKPVSQSVILGAKSLPASTLSNHLEQRLFKKLKQERQERAR
LQGKSYEEVPGADSLVIRVVASVDKILEVKPRFLDIFREDNYSSEFPYKSKAILLFQKIE
GVEVCLFGMYVQEFGTDSASPNQRRVYLSYLDSVKYFRPDVKTVSGEALRTFVYHEILIG
YLDYCKKRGFSSCYIWACPPLKGEDYILYCHPEIQKTPKTDKLREWYLAMLKKASKEKVV
VECTNFYDHFFVQSGECRAKVTAARLPYFDGDYWPGAAEDLIDQMSQEEDGKKSNRKLMP
KKVISKRALKAVGQLDLSVNASKDLLLMHKLGEIILPMKEDFIMVHLQHCCKHCCTLMVS
GNRWVCNQCKNFQICDKCQEVEENRVEKEKHPVNQKEKHVLYPVAIDDIPTEIKDNDAIL
ESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMILYHLHNPTVPAFATACAICQQELET
AQGWRCEVCPDYEVCNACYSKGINHPHSLIGRPSATDSVVQNTQTNQIQTAQLRELLLHV
MACCTAQCQYPRCRAIKGLIRHGLACKTRGCSHCKKMWALFRMHSRNCRDPQCKVPKCRE
LRAHFSRKQQQADSRRRAAVMEMVRQRAADATTSTPD
NT seq 4974 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggggcagaataggacagttcttcagccaggacagatgcagaattctgttgca
gcttctgcttctagtgtttcttctcagcctaatatggtcaatggcatatctcgtgataat
ctcttattacgacaggatatgctcaatagaatctacgcttggttacagcagaggcagcct
tcaaagactgatgatgcttccaaggcaaagttaattgaggttgcaaaacggttagagagt
gcaatgttgagaacggctaagtctaaggaggattacttagatttccgaagtttcgacgtt
cgcattgaatctaatctgaaacaacttcttagtcaacgccgtgctaatccttcaagctcg
gtcagtacgatggttcagacacctgcggtttcacatggatggaatcaaagttatacggcc
acccctatggtggatacaagcacattcaatagtagtaataacttatcagatgcaacaatc
gaaaccggacgactattgcaaactaatcacatgaacagaggttcaataaataatggtcgc
cagcaattatctacggttggccagatgattcctactcctggatttgacaatattgctaat
gctgatgtatatcagtctcatcgaaatgaagaatattctggagatggtggcaagcttctg
gctgctgggtctgacattggaaatccatctcagctgcagaagcaacgtcctactggttca
aatgaccgtatgctttacaaccttgatcaccagttgggaggtggtttcaggtcaaatatt
caccagaatacatctgggatgaccaatattccgctaaatgctggtgtagggatgagcggg
aacaatgtaaaccttgctaatgggcccaggagttcggaaggggtcctcagctctacgcat
tattcaacgttatcccaacccttgcagcagcctgtcgatcagttgcaggtgtcacatgtg
aacagatactcaatgagtaactctggtacttttgggtctgggaatctctatggaggtgta
acatcatcgggctcaatggaaactgctgtggatatgaattccatgagccagaattctatg
cggagagttgatgcttcattcggtagtcagtctagtctgcaaaacaatccattgctaaag
cctcaactacatcatcagttcgagaatgggaatttccaatcttcttccagttccaaagaa
aatttggctcaggtgagtcgtcgaccattagaacgtcaattcaaccaacaagctcatcat
ggtcaataccagcagcaagagctcttactgaataatgatggctatcgtcgatctcagcta
gcttcaaatttagttagtcaagttaagaatgaacctcgcgtggaatactacaatgaagct
tttcagatgcaggctataaataaaggagaaccatccaagccgcaaaaccaatacaagcag
aatgctgtgaaggacgagtatgttggtgctcagagtgcacccgtttctagtagcgagcta
aagatgtctccatctttcccaccacaaactcatcaggcacagcaggtatcacaatggaaa
gattcgagcaacctctcagctggagtgcagccagtatcaggtctgggtcagtggcattca
tcttcgcagaacttgacaccaatattaaaaagttctaatgaagagagagaacattttggg
gtaagatttcatatgcagcatgaaggtactaataatagttcgtctgtaagagagtctaca
aactgccaaactgttgctcctagaggcaccttggaggttccacatctcccagtaggaaac
aatgccttgagtaaacagctgaatggagattgtggtctaagttacaaaaatcagaggcgg
tggcttttgttcctgctacacgtacgaaaatgcaatgctgcagaagataactgtgaaagc
aagtattgttttacagccaaaacgctgttgaaacatatcaattactgcaaggcttctgct
tgcgcatatcaatattgtcgtcaaacccgacaattgattcatcattacaagcactgcggg
aatgaagcatgtccagtctgtgtttttgtcaaaaacttcaaggagaaacaaaaagaaaaa
tttaccttcctcaaaagagctgagcctagctcagctagtttaaagcatggacccaaggaa
tccttcgagtctatgcgtacttctagtgaaaaagactctgaagctccatttgttgttgat
gatttgcaaccatctccgaagcgccagaaagtagagaaaccctctcaatttgcttatcct
gacacacagggcatcccagtggcaatatctgctggtgtcagtcaagctcatttttcaatg
ggtttgcaagagaaagataggctacaaagtgatgtttgcaaacctgtcagatcaaatgtg
cctatgaatgcaggtagttctgattcttcaagaaggcttgttccagcttcccgtgagctg
gagaagcctgtttacaaagatggtgaaactgttcgtttatcgaagcaagaaaaaccaaag
cgtatgactgaaataagcgcacccaaagaagagaatgcggaacagtctttaggcattgta
tctgcgtctaatagcggaaagtcaaagatcaaaggagtctcactgattgagttgttcact
ccagagcaagtagaggagcatatccgcggtcttcgtcagtgggtaggccagagtaaaacc
aaggcagaaaaaaataaagcaatgggactctccatgtctgagaattcttgccagttatgt
gctgttgagaggcttgcatttgagccaacacctatttactgcacaccttgtggggcacgt
gtcaagagaaacgctatgcactatacggtagtggctggtgagtcacggcattatgtctgt
attccttgttacaacgaagcgcgtgcaaacactgtttctgttgatggtgcttctgtaccg
aagtcaaggtttgagaaaaagaaaaatgatgaagaggttgaagaatcgtgggtgcaatgt
gataaatgtcaagcatggcagcatcaaatttgtgctttgttcaacggccgtaggaatcat
gggcaagccgagtacacttgccctaattgctatatacaagaagtggaacaaggagaaagg
aaaccggtatcacaaagtgttattctgggggctaaaagtttgccagccagtactcttagc
aaccatttagaacagcggttgttcaagaaattgaagcaggaaagacaagagagggctaga
cttcaaggaaaaagctacgaggaggtcccgggagccgactcgcttgttatcagagttgta
gcatctgtcgacaaaatattagaagtaaagccacgtttccttgacattttccgagaagat
aattactcatcagaattcccttataagtctaaggccattctgttgtttcagaagattgaa
ggtgttgaagtatgcttatttggcatgtatgtccaggaatttggaacagattctgcgtct
cccaatcagcgccgggtatacctttcctatctggactcagttaagtacttcagacctgac
gttaaaacagtatctggagaggccctccgtacgttcgtataccatgaaattctgattggt
taccttgattactgtaagaaacgtgggttttcaagctgctatatatgggcatgcccccct
cttaagggtgaagattatattctatattgccatcctgaaattcagaaaacgccaaaaact
gacaaactaagggaatggtatctagcaatgctaaagaaagcttctaaggaaaaagtggtc
gttgagtgtacaaacttctatgaccattttttcgtccagtctggtgaatgtagagctaag
gtaacagcagcaaggttgccatattttgatggcgactactggccaggtgctgctgaggat
ttaatagatcaaatgagccaagaagaggatggcaaaaagtcaaatagaaaactaatgccc
aaaaaggtcatatcgaaaagggctctaaaagcagtaggtcagttggacctttctgttaat
gcctcgaaggatctcctgctgatgcataaactgggtgagatcatcctcccaatgaaggaa
gatttcatcatggttcatttgcaacattgttgtaagcattgttgcactctcatggtatct
ggaaatcgttgggtgtgcaaccagtgtaagaattttcagatttgtgacaagtgtcaggaa
gtggaagagaaccgtgtggaaaaggaaaaacatcccgtcaatcagaaggagaagcatgta
ctctatcctgttgccattgacgacattcctactgaaattaaggacaatgatgccatcctc
gagagcgagttctttgatactaggcaagctttcctgagtctttgccaaggtaatcactat
cagtacgacacactaagacgggcaaaacattcttctatgatgattctttatcaccttcac
aacccaaccgtccctgcatttgcaacggcatgtgccatctgccagcaagaacttgaaact
gctcaaggttggcgttgcgaagtttgccctgactatgaagtttgcaatgcttgctactca
aaaggtatcaaccatccacatagcctcattggccgtccatctgcgacagattctgttgta
cagaacacacaaactaatcaaattcagactgcccagttaagagagctgctgctacacgta
atggcatgctgcactgcacagtgccagtatccaaggtgtcgcgcgattaagggtctcatt
aggcatggtcttgcctgcaagaccagaggttgcagccattgtaagaaaatgtgggccctc
ttccgaatgcactctcgaaactgcagagatccccaatgcaaagtccccaaatgcagagag
ttgagagctcattttagtagaaagcagcaacaggcagattcaagacgcagagcagcggtg
atggagatggtgcggcagagagctgctgatgcaacgacctccactcctgactga

DBGET integrated database retrieval system