KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_898446Help
Entry
ARALYDRAFT_898446 CDS       T01578                                 

Definition
chloroplast aspartate carabmoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ARALYDRAFT_898446
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARALYDRAFT_898446
Enzymes [BR:aly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ARALYDRAFT_898446
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 397 aa AA seqDB search
MSIASSLSSATLCGASVFPKALGYSSEFPSNLPSPSESSKICLTSFPASRDPKKNATWNL
TRNVGPIQGIRCHAMQAGTRELKKFELSDVIEGKQFDREMLSAIFDVAREMEKIEKSSSQ
SEILKGYLMATLFYEPSTRTRLSFESAMKRLGGEVLTTENAREFSSAAKGETLEDTIRTV
EGYSDIIVMRHFESGAARKAAATANIPVINAGDGPGEHPTQALLDVYTIQSEIGKLDGIS
VALVGDLANGRTVRSLAYLLAKFKDVKIYFVSPEIVKMKDDIKDYLTSNGVEWEESSDLM
EVASKCDVVYQTRIQRERFGERLDLYEAARGKYIVDKDLLGVMQKKAIIMHPLPRLDEIT
ADVDADPRAAYFRHADPRAAYFRQAKNGLFIRMVHGR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgcgtcatcactttcttcagccacactttgcggcgcctcagtttttcctaaa
gcattaggctacagctctgagttcccaagcaatcttcccagtccttctgaaagttcaaag
atttgtttgacttcatttcctgcctctagggatcccaagaaaaatgctacttggaatcta
acccgaaatgttggtccgatccaaggaatcaggtgtcatgctatgcaagctgggacgagg
gaattgaagaaatttgaacttagtgatgtgattgaagggaaacaatttgatagggagatg
ctaagcgctatattcgatgttgcacgagaaatggaaaagatagaaaagagctcttcccaa
agtgaaattctcaagggttatttaatggctaccctcttttatgagccttctacccgtacc
aggctttcatttgaatctgccatgaaacgccttggaggtgaagtcttaactactgagaac
gctagagagttttcgtctgccgcgaaaggggaaacacttgaagacacaataagaacagtg
gagggttattcagatataattgtgatgcgacattttgaaagcggtgctgcaagaaaagct
gcagctactgccaatatacctgtcattaatgcaggtgatggtcctggagagcatcctact
caggctctattggacgtctataccatccaaagtgaaattggaaaattagatggcatcagt
gtagccttagttggagatcttgccaacggaaggacagtccggtctctggcatacttgctt
gccaagtttaaagacgtgaagatctactttgtttcccctgaaattgtgaaaatgaaggat
gatataaaagactacttgacatcaaacggggtcgaatgggaagaaagttcagatttaatg
gaagtagcatccaagtgtgatgtagtttatcaaacccgaatccaaagagagaggtttgga
gaaaggcttgacctttacgaagcagctcgtgggaagtatatcgtagacaaggatctgtta
ggagtaatgcagaaaaaagctattatcatgcatcctttaccgagattggatgaaatcact
gcagatgttgatgctgatccaagagctgcctacttcagacatgctgatccaagagctgcc
tacttcagacaagcaaagaacggtttgttcattagaatggttcatggtcgttaa

DBGET integrated database retrieval system