KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_898446Help
Entry
ARALYDRAFT_898446 CDS       T01578                                 

Definition
chloroplast aspartate carabmoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aly00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aly00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 397 aa AA seqDB search
MSIASSLSSATLCGASVFPKALGYSSEFPSNLPSPSESSKICLTSFPASRDPKKNATWNL
TRNVGPIQGIRCHAMQAGTRELKKFELSDVIEGKQFDREMLSAIFDVAREMEKIEKSSSQ
SEILKGYLMATLFYEPSTRTRLSFESAMKRLGGEVLTTENAREFSSAAKGETLEDTIRTV
EGYSDIIVMRHFESGAARKAAATANIPVINAGDGPGEHPTQALLDVYTIQSEIGKLDGIS
VALVGDLANGRTVRSLAYLLAKFKDVKIYFVSPEIVKMKDDIKDYLTSNGVEWEESSDLM
EVASKCDVVYQTRIQRERFGERLDLYEAARGKYIVDKDLLGVMQKKAIIMHPLPRLDEIT
ADVDADPRAAYFRHADPRAAYFRQAKNGLFIRMVHGR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtctattgcgtcatcactttcttcagccacactttgcggcgcctcagtttttcctaaa
gcattaggctacagctctgagttcccaagcaatcttcccagtccttctgaaagttcaaag
atttgtttgacttcatttcctgcctctagggatcccaagaaaaatgctacttggaatcta
acccgaaatgttggtccgatccaaggaatcaggtgtcatgctatgcaagctgggacgagg
gaattgaagaaatttgaacttagtgatgtgattgaagggaaacaatttgatagggagatg
ctaagcgctatattcgatgttgcacgagaaatggaaaagatagaaaagagctcttcccaa
agtgaaattctcaagggttatttaatggctaccctcttttatgagccttctacccgtacc
aggctttcatttgaatctgccatgaaacgccttggaggtgaagtcttaactactgagaac
gctagagagttttcgtctgccgcgaaaggggaaacacttgaagacacaataagaacagtg
gagggttattcagatataattgtgatgcgacattttgaaagcggtgctgcaagaaaagct
gcagctactgccaatatacctgtcattaatgcaggtgatggtcctggagagcatcctact
caggctctattggacgtctataccatccaaagtgaaattggaaaattagatggcatcagt
gtagccttagttggagatcttgccaacggaaggacagtccggtctctggcatacttgctt
gccaagtttaaagacgtgaagatctactttgtttcccctgaaattgtgaaaatgaaggat
gatataaaagactacttgacatcaaacggggtcgaatgggaagaaagttcagatttaatg
gaagtagcatccaagtgtgatgtagtttatcaaacccgaatccaaagagagaggtttgga
gaaaggcttgacctttacgaagcagctcgtgggaagtatatcgtagacaaggatctgtta
ggagtaatgcagaaaaaagctattatcatgcatcctttaccgagattggatgaaatcact
gcagatgttgatgctgatccaagagctgcctacttcagacatgctgatccaagagctgcc
tacttcagacaagcaaagaacggtttgttcattagaatggttcatggtcgttaa

DBGET integrated database retrieval system