KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_900526Help
Entry
ARALYDRAFT_900526 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_900526
   01230 Biosynthesis of amino acids
    ARALYDRAFT_900526
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_900526
   00051 Fructose and mannose metabolism
    ARALYDRAFT_900526
   00562 Inositol phosphate metabolism
    ARALYDRAFT_900526
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_900526
Enzymes [BR:aly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ARALYDRAFT_900526
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ARALYDRAFT_900526
  Exosomal proteins of bladder cancer cells
   ARALYDRAFT_900526
  Exosomal proteins of melanoma cells
   ARALYDRAFT_900526
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 314 aa AA seqDB search
MAATSLTAPPSFSGLRRISPKLDAAVSSHQSFFHRVSSSTRLVSSSSSSHRSPRGVVAMA
GSGKFFVGGNWKCNGTKDSIAKLVSDLNSATLEADVDVVVSPPFVYIDQVKSSLTDRIDI
SGQNSWVGKGGAFTGEISVEQLKDLGCKWVILGHSERRHVIGEKDEFIGKKAAYALSEGL
GVIACIGEKLEEREAGRTFDVCFAQLKAFGDAVPSWDNIVVAYEPVWAIGTGKVASPQQA
QEVHVAVRGWLKKNVSEEVASKTRIIYGGSVNGGNSAELAKEEDIDGFLVGGASLKGPEF
ATIVNSVTSKKVAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcagctacctctctcactgcccctccttctttctccggtctccgccgcatttctccc
aagctcgacgccgccgtctcctcccaccaatccttcttccaccgcgtcagttcctctacc
cgtctcgtttcttcctcttcttcttctcatcgctctcccagaggcgttgttgccatggct
ggatccggaaagtttttcgttggaggaaactggaagtgtaacgggactaaggactccatc
gccaagcttgtctctgatctcaacagtgcaaccttggaagcagatgtagatgttgttgtg
tcacctccatttgtctacatcgaccaggtcaaatcctcgttgacagaccgtattgacata
tcaggtcagaactcttgggttggaaaaggtggagccttcactggtgaaattagcgtggaa
cagcttaaagatcttggctgcaagtgggtcattcttgggcattccgaacggagacatgtc
atcggagaaaaagatgagtttatcgggaagaaagcagcttatgcattgagtgagggtctc
ggagtgatagcttgtattggggaaaagctagaagagagggaagcaggaaggacatttgat
gtttgcttcgcacaactgaaggcgtttggtgatgctgtacctagctgggacaatatagtt
gttgcatacgagcctgtatgggcaattggaactggtaaagttgcatctcctcagcaagca
caagaagtccatgtagctgtccgcggttggctaaaaaagaatgtctctgaggaagtcgct
tccaaaacgaggatcatatatggagggtctgtcaatggaggcaacagtgcagagcttgcc
aaagaagaagacattgatggatttcttgttggcggtgcctccttgaagggtcctgagttt
gcaaccattgtgaactcagtcacgtcgaagaaagttgctgcttga

DBGET integrated database retrieval system