KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_900986Help
Entry
ARALYDRAFT_900986 CDS       T01578                                 

Definition
ATRPA2/ROR1/RPA2
Orthology
K10739  
replication factor A2
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:aly03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:aly03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:aly03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aly03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 279 aa AA seqDB search
MFSSSQFEPNSAFSGGGFMSSQPSQAYESSSSTAKNREFQGLVPVTVKQITECFQTSGEK
SGLVINGISLTNVSLVGLVCDKDVSKVTEVRFTLDDGTGRIDCKRWVNETFDAREMESVR
DGTYVRVNGHLKTFQGKTQLLVFSVRPIMDFNEVTFHYIECIHFYSQNSESQGQQVGDVT
QSVNTTFQGGSNTNQATPLNPVVSSQNNDGNGRKNLDDMILDYLKQPACTARQQGIHIDE
IAQQLKVPKNKLEGVVQSLEGDGLIYSTIDEYHFKHVEL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgttctccagcagccaattcgagcctaattcagccttctccggcggcggattcatgtct
tctcaaccttctcaggcctacgaatcctcttcctccaccgctaagaatcgtgagtttcaa
ggtcttgttccagtgacggtgaagcaaatcactgaatgttttcagaccagtggtgaaaaa
tctggtctcgttatcaatggaatctcactaacaaacgtctcacttgttggtctagtgtgt
gataaagatgtttctaaagtcacagaagttagattcactcttgatgatggaacaggacga
attgactgtaaaagatgggtgaatgaaactttcgacgctagagaaatggagtcggtgcga
gatggaacttatgtgcgtgtcaatggtcatttgaagacttttcagggtaaaacgcagctt
ctagttttctctgtgaggcctattatggacttcaatgaggttacttttcactacattgag
tgtatacacttctactcccagaactctgaatcacagggacaacaagttggtgatgtcact
caatcggttaacactacgtttcaaggtggatcaaacacaaaccaggcaacaccattgaac
cctgtggtttcttctcaaaacaatgacggaaatgggcgcaagaacttggatgatatgatt
ctagactatctaaagcaacctgcttgcactgcaagacaacaggggatacacattgatgaa
attgctcagcaattgaaggtcccaaagaacaagctagagggcgttgttcaatcactggaa
ggagatggtctaatatactcgactatcgatgagtatcacttcaagcatgtcgagctttga

DBGET integrated database retrieval system