KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_900986Help
Entry
ARALYDRAFT_900986 CDS       T01578                                 

Definition
(RefSeq) ATRPA2/ROR1/RPA2
  KO
K10739  
replication factor A2
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:aly00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ARALYDRAFT_900986
   03420 Nucleotide excision repair
    ARALYDRAFT_900986
   03430 Mismatch repair
    ARALYDRAFT_900986
   03440 Homologous recombination
    ARALYDRAFT_900986
DNA replication proteins [BR:aly03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    ARALYDRAFT_900986
DNA repair and recombination proteins [BR:aly03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     ARALYDRAFT_900986
   MMR (mismatch exicision repair)
     ARALYDRAFT_900986
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     ARALYDRAFT_900986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 279 aa AA seqDB search
MFSSSQFEPNSAFSGGGFMSSQPSQAYESSSSTAKNREFQGLVPVTVKQITECFQTSGEK
SGLVINGISLTNVSLVGLVCDKDVSKVTEVRFTLDDGTGRIDCKRWVNETFDAREMESVR
DGTYVRVNGHLKTFQGKTQLLVFSVRPIMDFNEVTFHYIECIHFYSQNSESQGQQVGDVT
QSVNTTFQGGSNTNQATPLNPVVSSQNNDGNGRKNLDDMILDYLKQPACTARQQGIHIDE
IAQQLKVPKNKLEGVVQSLEGDGLIYSTIDEYHFKHVEL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgttctccagcagccaattcgagcctaattcagccttctccggcggcggattcatgtct
tctcaaccttctcaggcctacgaatcctcttcctccaccgctaagaatcgtgagtttcaa
ggtcttgttccagtgacggtgaagcaaatcactgaatgttttcagaccagtggtgaaaaa
tctggtctcgttatcaatggaatctcactaacaaacgtctcacttgttggtctagtgtgt
gataaagatgtttctaaagtcacagaagttagattcactcttgatgatggaacaggacga
attgactgtaaaagatgggtgaatgaaactttcgacgctagagaaatggagtcggtgcga
gatggaacttatgtgcgtgtcaatggtcatttgaagacttttcagggtaaaacgcagctt
ctagttttctctgtgaggcctattatggacttcaatgaggttacttttcactacattgag
tgtatacacttctactcccagaactctgaatcacagggacaacaagttggtgatgtcact
caatcggttaacactacgtttcaaggtggatcaaacacaaaccaggcaacaccattgaac
cctgtggtttcttctcaaaacaatgacggaaatgggcgcaagaacttggatgatatgatt
ctagactatctaaagcaacctgcttgcactgcaagacaacaggggatacacattgatgaa
attgctcagcaattgaaggtcccaaagaacaagctagagggcgttgttcaatcactggaa
ggagatggtctaatatactcgactatcgatgagtatcacttcaagcatgtcgagctttga

DBGET integrated database retrieval system