KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_903282Help
Entry
ARALYDRAFT_903282 CDS       T01578                                 

Definition
(RefSeq) phosphoinositide-specific phospholipase C family protein
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ARALYDRAFT_903282
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    ARALYDRAFT_903282
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    ARALYDRAFT_903282
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     ARALYDRAFT_903282
Membrane trafficking [BR:aly04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    ARALYDRAFT_903282
 Endocytosis
  Macropinocytosis
   Phospholipase C
    ARALYDRAFT_903282
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 618 aa AA seqDB search
MGKEKKTESYNNDSGSYNYKMFKCFNRKFKINEVTPTDDVRDAFCQFAVGGGGGGGGGTD
GDSSDGDGSSGVMGAEQLCSFLDDHQGESGTTVAEAQRLIDEVIRRRHHVTRFTRHGLDL
DDFFNFLFYEDLNPPITPHVHQDMTAPLSHYFIYTGHNSYLTGNQLSSDCSEVPVIKALQ
RGVRVIELDLWPNSTGTDINVLHGRTLTTPVPLIKCLKSIRDYAFSSSPYPVIITLEDHL
TPDLQAKVAEMATQIFGQMLYYPESDSLVEFPSPASLLHRIIISTKPPKEYLESRNPIVK
QKDNNVSPSSEEETPRTEEIQTLESMLFDQDFESKSDSDQEDEEASEDQKPAYKRLITIH
AGKPKGTVKEEMKVVVDKVRRLSLSEQELDRTCSSNSQDVVRFTQRNLLRIYPKGTRFNS
SNYKPLIGWTHGAQMIAFNMQGYGKSLWLMHGMFRANGGCGYVKKPNFLMKKGFHDEVFD
PRKKLPVKETLKVKVYMGDGWRMDFSHTHFDAYSPPDFYTKMFIVGVPADNAKKKTKIIE
DNWYPIWDEEFSFPLTVPELALLRIEVREYDMSEKDDFGGQTCLPVAELRPGIRSVPLYD
KKGEKMKSVRLLMRFIFE
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggagaagaaaacagagtcgtataataacgatagcggtagttacaattacaag
atgttcaaatgtttcaaccgtaaattcaagatcaacgaagtcacacctaccgacgacgtc
cgtgacgctttttgtcaattcgccgtcggtggcggcggtggaggaggaggcggaacagac
ggagattcaagtgacggagacggatcatccggtgtaatgggtgcagagcagctctgttct
ttccttgatgaccatcaaggtgaatcaggaaccaccgtcgcggaggctcaacggttaatc
gatgaggttatacgacggcgacaccacgtcacgcgcttcacgcgccacggacttgatctc
gacgatttcttcaatttcctcttttacgaggatctcaatcctcccattacgcctcacgtg
catcaagatatgacagctccattgtcacattacttcatatacacaggacacaattcgtat
cttacgggtaatcaactaagcagcgattgtagcgaagtccctgtgatcaaagccttgcaa
agaggcgttcgagtcatcgagctcgatctttggcctaactctactggaacagatatcaat
gtccttcacggaagaacgcttacaacacctgtaccgctgatcaaatgcttgaaatcgata
agagattacgcgttttctagttcgccttatccggttattatcactttagaggatcatctt
acacctgatcttcaagccaaagttgctgagatggctacacagatatttgggcagatgttg
tattaccctgaatcagatagcttagtggaatttccttctcctgcttcactgcttcatcgg
ataatcatctcaaccaaaccgcctaaagagtatctcgaatcgaggaatccgattgttaaa
cagaaggataataatgtatctccatcgtccgaggaagaaacacctagaacagaggagatt
cagacactagaaagtatgttgtttgaccaagattttgaaagcaagagtgatagtgatcaa
gaggatgaagaggctagtgaagatcagaaacctgcatacaaacggttgatcaccattcat
gcagggaaaccaaagggaacggtgaaagaagagatgaaagttgtggtggataaagtgaga
cgtttgagtttaagcgagcaggaacttgacaggacttgttcatccaatagtcaggatgtt
gtaaggtttacacagcggaatttgcttcggatataccctaaagggacaagatttaactcc
tcaaactacaaacctcttatcggttggactcacggagcgcaaatgattgcattcaacatg
cagggatatgggaaatctctgtggttgatgcacggcatgtttagagctaatggaggttgt
ggatatgtcaagaaacctaacttcttgatgaagaaagggtttcacgacgaagtctttgac
cctaggaagaaactccctgtgaaagaaacgttaaaggtgaaagtgtatatgggagatgga
tggcgtatggacttcagtcacactcactttgacgcatattctcctcctgatttctacact
aagatgttcatagtgggtgtaccagcggataacgcgaaaaagaagacaaaaataatcgaa
gacaattggtatccaatttgggatgaggaatttagtttcccattaaccgttccagagctt
gcattgcttaggatcgaagtaagagagtatgatatgtcggagaaggatgattttggggga
caaacatgcttgcctgttgcagaattaagaccggggattcgatctgtgccattgtatgat
aaaaagggtgagaaaatgaaatcagtacggcttcttatgcgtttcatcttcgaatga

DBGET integrated database retrieval system