KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_903395Help
Entry
ARALYDRAFT_903395 CDS       T01578                                 

Gene name
UBP5
Definition
ubiquitin-specific protease 5
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 924 aa AA seqDB search
MAEVSMGSSSSSTDLSPEEERVFIRDIAIAAEANSKEGDTFYLITQRWWQDWIEYVNQDQ
PCNTNDGSSLSEHCDSPGSSTLKKPSRIDNSDLIYDSSLEDPSNTSEIIETLQEGRDYVL
LPQEVWNQLRSWYGGGPTLARRVISSGLSQTELAVEVYPLRLQLLLMPKSDHSSIRISKK
ETIRELHRRACEIFDLNSEHVRIWDYYGHQKYSLMNDLDKTLDDANLQMDQDILVEVLDI
NGTLSSAHIQSAQENGLVDEDSTSILIEPSKSSLAAAGGFSSSRNAFRTGSVEVSQSFDS
TYSSTGVTTRGSTAGLTGLLNLGNTCFMNSAIQCLVHTPEFASYFQEDYHQEINWQNPLG
MVGELALAFGDLLRKLWAPGRTPIAPRPFKAKLARFAPQFSGYNQHDSQELLAFLLDGLH
EDLNRVKHKPYINSRDADGRPDEEVADEFWANHIARNDSIIVDVCQGQYKSTLVCPICNK
VSVTFDPFMYLSLPLQFNTTRAITVTVFSCDKTALPSTITVNVSKQGRCRDLIQALTSAC
SLKQSEELKLAEIRNNFIHRLFEDPLIPLSTIKDDDHLAAYKLSKSSENTTLLRLVLRRR
DQKAGERESTVQLKPCGTPLLSSASRGDALTKGKIHCLIQNMLSPFRREESVGKRGNSDS
SIPERRSARFNNSEEEDKVDGLKKAKKSNSSELGASKLSLQLIDENNKTINLPDDEAEAI
KLPSSATVTIYLDWTPELSGMYDITCLESLPEVLKYGPATKKARSEPLSLYACLEAFLRE
EPLVPDEMWFCPQCNERRQASKKLDLWRLPEVLVIHLKRFSYSRSMKHKLETFVNFPVHD
LDLTKYVANKNLSQPQLYELYALTNHYGGMGSGHYTAHIKLLDDNRWYNFDDSHISHINE
DDVKSGAAYVLFYRRKSDAGGEMK
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagtatcgatgggaagcagcagtagcagcacggatctgtctcccgaggaagag
cgagttttcatcagagacattgctattgctgctgaggctaacagcaaagaaggcgataca
ttttatctcatcactcagagatggtggcaagactggattgagtatgtgaatcaagaccaa
ccatgtaacactaatgatgggtcttcactgtcagagcattgcgactctcctggttcaagc
acactaaagaagccttctaggattgataactctgatttgatctatgattcttcgctggag
gacccgagtaataccagtgagattattgaaacacttcaggaaggtcgtgactatgttttg
ctccctcaagaagtgtggaaccagttgcgttcatggtacgggggtggtccaactctagca
cggagagtcattagctcaggtctctctcaaacggagttggctgtagaggtttacccttta
cgtcttcagctacttctgatgccaaaaagtgaccatagttccataagaattagcaaaaag
gaaactatcagagagctccatcgaagagcctgtgaaatttttgacctcaactcagagcat
gtacgcatttgggattactacggccaccaaaagtattctttgatgaatgacttagataag
acactggacgatgctaacctacaaatggatcaggatattttggtggaggtgcttgacatc
aatggtacattatcaagtgctcacattcaatctgctcaagagaacggattggtggatgaa
gactctacttctattctcattgagccttctaaatcaagcttggctgctgcaggagggttc
tcttcaagcaggaatgcattcagaactggtagtgtagaagtttcacaatcttttgatagc
acatacagtagcactggcgtcacaacaaggggatccacagctggcttaacagggctgcta
aatctcgggaatacttgtttcatgaatagtgcgattcagtgtctggttcatacacctgag
tttgctagttactttcaagaagattatcatcaagaaataaattggcaaaacccccttggc
atggtgggagaattagctctcgcatttggtgacttgctcaggaagttatgggctcctggg
cgcacaccaattgcacctcgtccattcaaagctaaacttgctcgctttgctcctcaattt
agtgggtacaatcaacatgattcgcaggagcttttagcgtttctgctggatggtcttcac
gaggacctaaatcgtgttaaacacaaaccatatataaattctcgagacgcagatgggcgc
cctgatgaagaagttgctgatgagttttgggctaatcatattgctcgtaatgactcaata
atcgttgatgtttgtcagggccaatataagtcaacattggtgtgtccaatctgcaacaag
gtttctgtaacatttgaccccttcatgtacctgtctttgccgcttcagttcaacacaaca
cgagcaataacagtcacagttttttcttgtgataaaactgccttaccttccactatcaca
gtcaatgtttcaaagcagggacgttgcagagacttgattcaggcattaacaagtgcttgt
tccttgaagcaaagtgaagagctgaaacttgcagagattcggaataattttatccatcga
ttatttgaagaccctttaattccattgtccactatcaaagacgatgatcaccttgctgca
tacaaactttcgaagtcttcggagaatacgactttgcttagactagtacttcgccgcaga
gatcagaaagctggggaacgcgaaagtacagttcaattgaaaccctgtggaacacccctt
ctctcatcagcttcacgtggagatgcactcaccaaaggaaaaatccattgcctcatccag
aatatgctttcaccttttcggagggaagaatctgtgggcaaaagaggaaattctgattct
agtatccccgagagaaggtcagctcgatttaataattctgaggaagaagataaagttgat
ggactgaaaaaagccaagaaaagcaactcctccgaattgggtgcttctaaattatccctg
caactcattgatgaaaacaataaaacgattaatctgccagacgatgaagcagaagctatt
aaattaccgtcatcagctacagtaactatttatttggattggacaccagaactctctggt
atgtatgatataacttgcctggagagtttgcctgaagttctcaaatatggacctgctacc
aagaaggctcgttcagaacctctttctttatatgcctgtttggaagcgtttctacgcgaa
gagcctttggtgcctgacgaaatgtggttctgtccacagtgcaatgaaagaaggcaggca
agcaaaaagcttgatctgtggaggcttcctgaagtcttagtcatacatctaaagagattc
tcatacagcagatccatgaagcataaattggaaacatttgttaactttcctgtccatgac
ttagatctaacaaagtatgtagccaacaaaaacctatctcaaccacagctatatgagctc
tatgccttgaccaaccattatggtggtatgggcagcggacactacactgcacatatcaag
cttttggacgacaataggtggtataacttcgatgacagtcatatatcacatataaacgag
gatgatgtgaagtcaggtgctgcttatgtgctcttctacaggaggaagtctgatgcaggt
ggagaaatgaaatag

DBGET integrated database retrieval system