KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_903782Help
Entry
ARALYDRAFT_903782 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:aly00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    ARALYDRAFT_903782
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     ARALYDRAFT_903782
Protein kinases [BR:aly01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   ARALYDRAFT_903782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 398 aa AA seqDB search
MDGGSGQPAADTEMTEALGGVPAAASSQPSPQMPGIENIPATLSHGGRFIQYNIFGNIFE
VTAKYKPPIMPIGKGAYGIVCSAMNSETNESVAIKKIANAFDNKIDAKRTLREIKLLRHM
DHENIVAIRDIIPPPLRNAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQILRGL
KYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARVTSESDFMTEYVVTRWYRAPELLLN
SSDYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPSEEELEFLNENAKR
YIRQLPPYPRQSITDKFPTVHPLAIDLIEKMLTFDPRRRITVLDALAHPYLNSLHDISDE
PECTIPFNFDFENHALSEEQMKELIYREALAFNPEYQQ
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggacggtggttcaggtcaaccggcggctgatacagagatgacggaagctctcggtggt
gttcccgcggcggcttcttctcagccatcgcctcagatgcctgggattgagaatattccg
gcgactcttagccatggtggtaggtttattcagtataacatatttggaaacatctttgag
gtcaccgctaagtataagcctccgatcatgcctattggcaagggtgcttatggcatcgtt
tgttcggctatgaactctgaaacaaatgagagcgttgcaattaagaaaatcgctaacgct
tttgacaataagattgatgcaaagaggactctccgtgagattaagctgcttcgtcacatg
gatcatgaaaatattgttgcaatcagagatataatcccgccaccattaagaaacgctttc
aacgatgtttacatcgcgtatgagctaatggacactgatctccatcaaatcatacggtca
aatcaagcattatccgaagaacattgccagtattttctttaccagatcctccgtggattg
aaatacattcattccgcaaatgtgcttcacagggatttgaaacctagtaatctccttctg
aacgcaaactgcgacctaaaaatctgcgattttgggctagctcgagtcacttccgagagt
gatttcatgactgaatatgttgtcacgagatggtaccgtgcaccagagctgctcttaaac
tcttctgattatactgcagctatcgatgtttggtctgtaggctgtattttcatggagtta
atggaccgtaagccactcttccctggacgagatcatgtccatcagcttcgcttgctcatg
gagctcataggaactccatcagaagaagagcttgagttcttgaacgaaaacgcaaagcga
tacataagacagcttccaccttatcctcgccaatccatcactgataagttcccgacagtg
catcctttagctatagaccttatcgagaagatgttaacatttgatcctagacggagaatc
acagttttagacgcattggcccatccatacctgaactcgttgcacgacataagcgatgag
ccagagtgtacgatacctttcaactttgattttgaaaaccatgcactctcagaggagcaa
atgaaggaacttatctaccgcgaggcgcttgctttcaatccagaatatcagcaatag

DBGET integrated database retrieval system