KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_905953Help
Entry
ARALYDRAFT_905953 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARALYDRAFT_905953
Enzymes [BR:aly01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ARALYDRAFT_905953
Peptidases [BR:aly01002]
 Cysteine Peptidases
  Family C44
   ARALYDRAFT_905953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 584 aa AA seqDB search
MCGILAVLGCSDDSQAKRVRVLELSRRLRHRGPDWSGLYQNGDNYLAHQRLAVIDPASGD
QPLFNEDKTIVVTVNGEIYNHEELRKRLKNHKFRTGSDCDVIAHLYEEYGVDFVDMLDGI
FSFVLLDTRDNSFMVARDAIGVTSLYIGWGLDGSVWISSEMKGLNDDCEHFETFPPGHFY
SSKLGGFKQWYNPPWFNESIPSTPYEPLAIRRAFENAVIKRLMTDVPFGVLLSGGLDSSL
VASITARHLAGTKAAKQWGPQLHSFCVGLEGSPDLKAGKEVAEYLGTVHHEFHFSVQDGI
DAIEDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEIFGGYLYFHKAPN
KQEFHQETCRKIKALHKYDCLRANKSTSAFGLEARVPFLDKDFINTAMSLDPECKMIKPE
EGRIEKWVLRRAFDDEERPYLPKHILYRQKEQFSDGVGYSWIDGLKDHAAQNVNDKMMSN
AAHIFPHNTPNTKEAYYYRMIFERFFPQNSARLTVPGGATVACSTAKAVEWDASWSNNMD
PSGRAAIGVHLSAYDGKNVALPMPPLKAIDDMPMMMGQGVVIQT
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaatacttgccgttttaggatgttccgacgattctcaggccaagagagttcgt
gttcttgagctttctcgcagattgaggcacagaggacctgactggagtggattatatcag
aacggagacaattacttggcccatcaacgtcttgcggtcatcgatcctgcctccggtgat
caacctctcttcaacgaagacaagaccattgttgtcacggtgaatggagagatttataac
catgaggagctgagaaaacgtttgaagaatcacaagttccgtaccggtagtgattgtgac
gtcattgcgcacttgtacgaggagtatggtgtggattttgttgatatgttggatggaatc
ttctcatttgtgttacttgacacaagagataattccttcatggtggctcgtgacgcgatt
ggtgtcacttcgctctacattggctggggattagatggatctgtctggatatcttcagag
atgaaagggttaaatgacgattgtgagcatttcgaaacgtttcctccaggtcatttttat
tcaagcaaattaggagggtttaagcaatggtacaatcctccttggttcaatgaatccatt
ccttcaacgccttatgaacctcttgcgataagacgcgcctttgaaaacgctgtgattaag
cggttaatgaccgatgttccctttggagttttactctctggtggtcttgattcttccctt
gttgcctccatcactgcccgtcacttggccggtactaaagcagctaagcaatggggtccg
cagctccattccttttgcgttggtcttgagggctcgccggacttgaaggcagggaaagag
gtggcggaatatttggggacggtgcaccacgagttccacttctcggtgcaggacgggatt
gatgcaatagaggatgtgatttaccatgtggagacttatgatgtgacgactatcagagcg
agcacaccgatgttcttgatgtcccggaaaatcaagtctctaggggtcaagatggttctc
tctggtgaaggttccgacgagatctttggagggtatctctatttccataaggcacctaac
aagcaagagtttcaccaagaaacttgtcgcaagatcaaggctcttcacaagtatgactgt
ctaagagccaacaaatctacatctgcctttggactagaggcgcgtgttcctttccttgac
aaagatttcatcaacacagctatgtctctcgaccctgaatgcaagatgatcaagccagag
gaagggaggatcgagaaatgggttctaaggagagcctttgacgacgaagaacgtccttat
ctgccaaagcatattctctacagacagaaagaacagttcagtgatggagttggctacagt
tggatcgatggcctgaaagatcacgctgctcaaaacgttaatgacaagatgatgtccaac
gcggcgcatatattccctcacaacactccaaacactaaagaagcttactactacagaatg
atctttgagaggttcttcccacagaactctgcgagactaacggttcctggaggtgcgaca
gtggcttgttcgactgcaaaggcagtggagtgggatgcaagctggtccaacaatatggat
ccatcaggaagagccgccataggagttcacctctcggcctacgacggcaagaacgtggca
ttgcccatgccgccacttaaggcaattgacgacatgccgatgatgatgggtcaaggagtt
gtgattcagacgtaa

DBGET integrated database retrieval system