KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_905963Help
Entry
ARALYDRAFT_905963 CDS       T01578                                 

Definition
(RefSeq) pectinesterase family protein
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00040  Pentose and glucuronate interconversions
aly01100  Metabolic pathways
Module
aly_M00081  Pectin degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARALYDRAFT_905963
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ARALYDRAFT_905963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pectinesterase PMEI Pectate_lyase_3
Motif
Other DBs
NCBI-GeneID: 9311906
NCBI-ProteinID: XP_002875838
UniProt: D7LND0
Position
Unknown
AA seq 594 aa AA seqDB search
MLRGIFHICLLASFLLLPFSSAVHDSGFTGGTDAPPPWDHNVSPPPETAPSPTPTSSPST
ASPPSPGPVAAPSPINNGSVSGDMTWWCNKTPHAETCNYYFRKSSQNNINIRPPRFRSEF
LRMLVRIALDQAVITHSQTVKFGPSCTNNQRKAAWSDCVKLFQNTVTQLNRTLKGLNPAA
KDDVKCTDFDAQTWLSTAQTNIETCRSGSEDLNVSDFVMPAISNKNLSDLIGNCLAVNGV
LMKQHNHTTAANHKEYFPSWVSRHERKLLVSATLAKSMPHLVVAQDRSGHFRSIQAAINF
AARRRFKSRFVIYVKKGVYRENIDVGNDNHNIMLVGDGERKTIITSGRSVQHGYTTYNSA
TAGFGGQRFVAKDMTFINTAGPLRGQAVAVRSSSDLAVFYRVGIHGFQDTLYIHSQRQFF
RECYISGTIDFIFGNAAVVFQNCMILVRRPLHGQANIITAQGRGDPFQNTGITIHSSRII
AASDLKPVIRAYKTYLGRPWQAYSRVTIMKTYIDNSISPLGWSPWLRGSNFALNTVFYGE
YKNFGPGSSTRWRVRWKGFHAITSTAVASRFTVGSLIAGGSWLPATGVPFKSGL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgcttagaggcatcttccacatttgcctcttggcctcatttcttcttctaccgttctcc
tctgctgtacacgacagtggcttcaccggtggtaccgatgctcctcctccgtgggaccat
aatgtttccccaccaccagaaaccgcaccatccccaacccccacctcgagtccttctacc
gcctctccaccgtctcccggaccagtggctgcaccatctccgatcaacaacggctctgtc
tctggagacatgacatggtggtgcaacaagactccacacgctgagacatgcaattactac
ttccggaagagctcacaaaacaacattaacatacgaccaccaaggttccggtccgagttc
ttacggatgctggtcaggatagcacttgaccaagccgtaatcacacacagtcaaaccgtt
aagttcggaccaagctgcaccaacaaccaaaggaaagccgcttggtcagactgcgtaaag
ctctttcaaaacacggtgactcagctaaaccgaacgctcaagggacttaacccggcggct
aaggatgatgtcaagtgtacagacttcgacgcacagacttggctcagcacggctcaaacc
aacattgaaacgtgccggtccggatccgaggatcttaacgtctcagatttcgtcatgccg
gcgatatctaacaagaacttgtcggatttgattggaaactgcttggccgtcaatggagtt
ctcatgaagcaacataatcatacgactgctgctaaccacaaagaatacttcccaagctgg
gtttcaagacacgagagaaaattactcgtatcagccactttagcgaaatcgatgcctcac
ctagtggtggcacaagacaggtccggccatttccggtcgatccaagctgccataaacttc
gcagcaagaaggagattcaagtcaagatttgtgatatatgtgaagaaaggtgtttaccga
gagaacattgatgtcggaaatgataaccacaacatcatgctcgtcggcgatggcgaaaga
aaaacaatcatcacaagtggccgaagcgtccagcacggctacaccacctataactctgca
accgccggctttggaggccaaaggttcgtagcaaaagacatgacattcatcaacacggcg
gggccattacgtgggcaagctgtggcggttcgatcatcctctgacctcgctgttttctac
cgtgttggtatccatggcttccaagacacgctctacattcattcacaacgccagttcttt
agggaatgttacatctcaggcaccatcgactttatctttggaaatgcagctgttgtgttc
cagaactgcatgattcttgtccgaagacctctccatggccaagccaacatcataaccgca
caaggtcgcggtgacccttttcaaaatacagggataaccatccatagctcaaggataatc
gcggcatctgatttgaagcctgtgattcgagcttacaagacctatttaggccgaccgtgg
caagcttattcacgcgtcacaatcatgaagacctatatagataactcgatcagccccttg
ggatggtctccttggttaagaggatccaattttgctcttaatacagttttctatggagag
tataaaaattttgggccggggtcttccacaagatggcgggtccggtggaaaggattccac
gccataacgagcacggcggttgcttctcggtttactgtgggaagtcttatcgctggcggt
tcatggttgccagccactggcgtgccgttcaagtcagggttgtga

DBGET integrated database retrieval system