KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_906076Help
Entry
ARALYDRAFT_906076 CDS       T01578                                 

Definition
protein-l-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Enzymes [BR:aly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ARALYDRAFT_906076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 230 aa AA seqDB search
MKQFWSPRSINKNKAMVEKLQNHGIVTSDEVAKAMEAVDRGVFVPDRSSAYVDCPMSIGY
NVTISAPHMHAMCLQLLEKHLKPGMRVLDVGSGTGYLTACFAVMVGSQGRAIGVEHIPEL
VASSVKNIEASAASPLLKEGSLAVHVGDGRQGWAEFAPYDAIHVGAAAPEIPEALIDQLK
PGGRLVIPVGNIFQDLQVVDKNSDGSVSIKNETSVRYVPLTSREAQLRGD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattctggagtccaagaagtatcaacaagaacaaagctatggtggagaagctg
caaaatcatggtatagttacgtcagatgaagttgctaaagctatggaggcagtggataga
ggcgtatttgtaccagatcgttcctctgcttatgtagattgtcccatgtctattgggtat
aatgtgactatatcagcacctcatatgcacgcaatgtgtcttcaacttcttgaaaaacat
ttgaaaccgggaatgcgtgttcttgatgtcggctcggggactgggtacttaacggcttgc
tttgcggttatggttggatcccaagggcgtgctattggtgtggaacatattcctgagctg
gtggcttcttctgttaagaatattgaagcgagtgctgcttcgccattgttgaaagaaggg
tctcttgctgttcatgttggcgatgggaggcaaggatgggctgagtttgctccttatgat
gctattcatgtcggagcagcagcaccggagatcccagaggcgttgattgatcagttgaag
cccggtgggagactggtgatcccggttgggaacatattccaagatctgcaagtggtggac
aagaactcagatggttcggttagcatcaagaatgaaacctcagttcgttatgttcctttg
actagccgtgaagcccagctgagaggggactga

DBGET integrated database retrieval system