KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_906963Help
Entry
ARALYDRAFT_906963 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_906963
   01230 Biosynthesis of amino acids
    ARALYDRAFT_906963
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_906963
   00051 Fructose and mannose metabolism
    ARALYDRAFT_906963
   00562 Inositol phosphate metabolism
    ARALYDRAFT_906963
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_906963
Enzymes [BR:aly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ARALYDRAFT_906963
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ARALYDRAFT_906963
  Exosomal proteins of bladder cancer cells
   ARALYDRAFT_906963
  Exosomal proteins of melanoma cells
   ARALYDRAFT_906963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDF
YVAAQNCWVKKGGAYTGEVSAEMLVNLDIPWVILGHSERRAILNESNEFVGDKVAYALAQ
GLKVIACVGETLEEREAGSTMDVVAAQTKAIADRVSNWSNVVIAYEPVWAIGTGKVASPA
QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaagttcttcgtcggaggcaactggaaatgcaacggaactgctgaggaggtg
aagaagattgtgaacactcttaatgaagctcaagtaccttcacaggatgttgtagaggtt
gtggttagccctccatatgttttccttcccctggttaagagtacattgaggtctgacttt
tatgttgcggcacaaaactgttgggttaagaaaggtggtgcttacactggtgaagtgagc
gctgagatgcttgtgaacttggacatcccatgggttatccttggtcactctgaaaggagg
gcaatccttaatgaatcaaacgagtttgtcggagacaaggttgcctatgcacttgctcaa
ggtttgaaagtgattgcttgtgttggtgagactcttgaggagcgggaagctgggtcgacc
atggatgttgtggctgcccagaccaaagctatcgctgatcgggtgtcaaactggtcaaat
gttgtcatagcctatgagccagtgtgggccattggaaccggaaaggtcgctagcccagct
caagctcaagaagtacatgatgagcttaggaaatggctggccaagaacgtgagtgctgat
gttgctgctacaacccgcatcatttatggaggatccgtcaatggtggtaactgcaaggag
ctaggtggtcaggccgatgttgatggtttcttggtcggtggtgcttctctaaagcctgag
tttatcgacatcattaaggctgcagaggtgaaaaaaagcgcttaa

DBGET integrated database retrieval system