KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_906963Help
Entry
ARALYDRAFT_906963 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ARALYDRAFT_906963
   01230 Biosynthesis of amino acids
    ARALYDRAFT_906963
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_906963
   00051 Fructose and mannose metabolism
    ARALYDRAFT_906963
   00562 Inositol phosphate metabolism
    ARALYDRAFT_906963
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_906963
Enzymes [BR:aly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ARALYDRAFT_906963
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ARALYDRAFT_906963
  Exosomal proteins of bladder cancer cells
   ARALYDRAFT_906963
  Exosomal proteins of melanoma cells
   ARALYDRAFT_906963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 254 aa AA seqDB search
MARKFFVGGNWKCNGTAEEVKKIVNTLNEAQVPSQDVVEVVVSPPYVFLPLVKSTLRSDF
YVAAQNCWVKKGGAYTGEVSAEMLVNLDIPWVILGHSERRAILNESNEFVGDKVAYALAQ
GLKVIACVGETLEEREAGSTMDVVAAQTKAIADRVSNWSNVVIAYEPVWAIGTGKVASPA
QAQEVHDELRKWLAKNVSADVAATTRIIYGGSVNGGNCKELGGQADVDGFLVGGASLKPE
FIDIIKAAEVKKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccagaaagttcttcgtcggaggcaactggaaatgcaacggaactgctgaggaggtg
aagaagattgtgaacactcttaatgaagctcaagtaccttcacaggatgttgtagaggtt
gtggttagccctccatatgttttccttcccctggttaagagtacattgaggtctgacttt
tatgttgcggcacaaaactgttgggttaagaaaggtggtgcttacactggtgaagtgagc
gctgagatgcttgtgaacttggacatcccatgggttatccttggtcactctgaaaggagg
gcaatccttaatgaatcaaacgagtttgtcggagacaaggttgcctatgcacttgctcaa
ggtttgaaagtgattgcttgtgttggtgagactcttgaggagcgggaagctgggtcgacc
atggatgttgtggctgcccagaccaaagctatcgctgatcgggtgtcaaactggtcaaat
gttgtcatagcctatgagccagtgtgggccattggaaccggaaaggtcgctagcccagct
caagctcaagaagtacatgatgagcttaggaaatggctggccaagaacgtgagtgctgat
gttgctgctacaacccgcatcatttatggaggatccgtcaatggtggtaactgcaaggag
ctaggtggtcaggccgatgttgatggtttcttggtcggtggtgcttctctaaagcctgag
tttatcgacatcattaaggctgcagaggtgaaaaaaagcgcttaa

DBGET integrated database retrieval system