KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_908123Help
Entry
ARALYDRAFT_908123 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
Chromosome and associated proteins [BR:aly03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    ARALYDRAFT_908123
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ARALYDRAFT_908123
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa MotA_ExbB RAMP4
Motif
Other DBs
NCBI-GeneID: 9307050
NCBI-ProteinID: XP_002873061
UniProt: D7M7U7
Position
Unknown
AA seq 132 aa AA seqDB search
MAPKAEKKPAEKAPAPKAEKKIAKEGGTSESIKKKKKTKKSTETYKIYIFKVLKQVHPDI
GISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREIQTAVRLVLPGELAKHAVS
EGTKAVTKFTSS
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgaaggcagagaagaaaccggcggagaaagcaccagcaccaaaggcggagaag
aagatcgcgaaagaaggaggaacgagcgagagtataaagaagaagaagaagacgaagaag
agcacggagacgtacaagatctacattttcaaggtattgaaacaggttcatccagatatt
ggaatctctggtaaagcaatgggaatcatgaacagtttcatcaacgacatcttcgagaaa
ctcgctcaggaatcgtctcgtctcgctcggtacaataagaaaccgacgatcacgtctcgt
gaaatccaaaccgctgtgagacttgttttgcctggtgaattggctaagcatgctgtctct
gaaggaaccaaagccgtcaccaaattcacaagctcttaa

DBGET integrated database retrieval system