KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_908981Help
Entry
ARALYDRAFT_908981 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aly00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 578 aa AA seqDB search
MCGILAVLGCVDNSQAKRSRIIELSRRLRHRGPDWSGLHCFEDCYLAHERLAIVDPTSGD
QPLYNEDKTIAVTVNGEIYNHKALRENLNSHQFRTGSDCEVIAHLYEEHGEEFVDMLDGM
FAFVLLDSRDKSFIAARDAIGITPLYIGWGLDGSVWFASEMKALSDDCEQFMCFPPGHIY
SSKQGGLRRWYNPPWFSELVPSTPYDPLLVRNTFEKAVIKRLMTDVPFGVLLSGGLDSSL
VASVALRHLEKSEAACQWGSKLHTFCIGLKGSPDLKAGREVADYLGTRHHELHFTVQDGI
DAIEEVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVLSGEGSDEIFGGYLYFHKAPN
KKEFHEETCRKIKALHQYDCLRANKSTSAWGVEARVPFLDKEFINVAMSIDPEWKMIRPD
LGRIEKWVLRNAFDDEKNPYLPKHILYRQKEQFSDGVGYSWIDGLKEHANKHVSDTMLMN
ASFVFPDNTPLTKEAYYYRTIFEKFFPKSAARATVPGGPSVACSTAKAVEWDAAWSQNLD
PSGRAALGVHVSAYGEDKTEDSRPEKLQKLAEKTPAIV
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattcttgctgtgttaggctgcgttgataactctcaagctaaacgttcccgt
atcatcgaactctctcgcagattgaggcatagaggtcctgactggagtgggctacattgt
tttgaggattgttatttggctcatgagcgtttggctatcgttgaccccacttctggagat
caaccgctctataacgaagataagaccattgctgtcacggtcaatggagagatatacaac
cacaaggctttgcgtgaaaatctgaattctcaccagttccgtactgggagtgattgtgaa
gtgattgcccatctttatgaagaacatggagaggaatttgtcgacatgttggatggcatg
tttgcatttgttcttcttgattcccgagacaaaagctttattgctgcaagggatgccatt
ggtatcactccactctacatcgggtggggtctcgatggttctgtctggtttgcttccgag
atgaaagcacttagtgatgattgtgaacagtttatgtgcttccccccaggccacatctat
tcaagtaaacaaggtgggcttaggaggtggtacaaccccccgtggttctctgagttggtt
ccttcaaccccatatgatcccctattggtgcgcaatacttttgagaaggctgttataaaa
cgactaatgactgatgtgccttttggtgtcctcctatctggaggattagactcatccctt
gttgcttcagtagcgttacgccatctggaaaaatcagaagctgcttgtcagtggggttca
aagttgcacacattttgtatcggtttgaagggatccccggatctgaaagctggcagagaa
gtcgctgactatttaggaactcgccaccatgagttacactttacagtccaggacggaata
gatgccatagaagaagtcatataccatgttgagacctatgacgtaactactataagagcc
agcactccaatgtttctaatgtcgagaaaaatcaaatcgcttggtgtaaagatggttctt
tctggggaaggctctgatgaaatttttggaggatatttgtacttccataaagcacccaac
aagaaggaatttcacgaggaaacatgtcgaaagatcaaagctcttcatcagtatgattgc
ttgagagctaacaaatcaacttctgcatggggtgttgaggctcgtgtacctttcctggat
aaagaatttattaatgtcgcgatgagcatcgatccagagtggaagatgattaggcctgat
ttgggaaggatcgagaaatgggtgttacgcaatgcctttgatgatgagaaaaatccttac
ctaccaaagcacattctatataggcagaaagaacagttcagtgatggagttggatacagc
tggattgatggtctaaaagaacatgcgaacaaacatgtctctgacacaatgctgatgaac
gcaagctttgtcttccctgataacacacctttgacaaaagaagcttactactacagaacc
atctttgaaaagttcttccctaagagtgctgctagagcaactgtaccaggaggtccaagt
gtggcatgtagtacagcaaaagctgtggaatgggacgcagcttggtcacagaatcttgac
ccatcaggtcgtgcggctcttggagttcatgtttcagcttatggggaagataaaaccgaa
gattctcgtcccgagaagctacagaaactagcagagaagactccagccattgtttga

DBGET integrated database retrieval system