KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_909099Help
Entry
ARALYDRAFT_909099 CDS       T01578                                 

Gene name
DXPS3
Definition
1-deoxy-D-xylulose 5-phosphate synthase 3
Orthology
K01662  
1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Thiamine metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ARALYDRAFT_909099 (DXPS3)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ARALYDRAFT_909099 (DXPS3)
Enzymes [BR:aly01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     ARALYDRAFT_909099 (DXPS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 701 aa AA seqDB search
MGSASIGYQIGISARFYGNFNLSSDVTVSSLPCKVDVSIKSLFSAPSSTHKECSNRARVC
CSLPNTDEYCDEKFETPILDTIETPLQLKNLSVKELKLLADEIRTELHSVLWKKTQKSMN
PSFAAIELTLALHYVFRAPVDNILWDAVEQTYAHKVLTRRWSAIPSRQKNGTSGVTSQLE
SEYDSFGTGHGCNSTSAGLGLAVARDIKGKRDRVVAVIDNATITAGQAYEAMSNAGYLDS
NMIVILNDSRHSLHPNMEEGSKASISALSSIMSKIQSSKIFRKFRELAKSMTKRIGKGMY
EWAAKVDEYARGMVGPTGSTLFEELGLYYIGPVDGHNIEDLVCVLREVSSLDSMGPVLVH
VITEENRDAETGKNIMVKDRRTYSDCFVEALVMEAEKDRDIVVVHAGMEMDASLITFQER
FPDRFFNVGMAEQHAVTFSAGLSSGGLKPFCIIPSAFLQRAYDQVVHDVDRQRKAVRFVI
TSAGLVGSDGPVQCGAFDIAFMSSLPNMIAMAPADEDELVNMVATAAYVTDRPVCFRFPR
GSIVNRNYLVPTGLPIEIGRGRVLVEGQDVALLGYGAMVQNCLHAHSLLSKLGLNVTVAD
ARFCKPLDIKLVRDLCQNHKILITVEEGCVGGFGSHVAQFIALDGQLDGNIKWRPIVLPD
GYIEEASPREQLALAGLTGHHIAATALSLLGRTREALLLMS
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcttcgattggttaccaaatcggaatctcagctcgattttacgggaatttt
aatttgagctcagatgttactgtttcctcgcttccatgtaaagttgatgtttccataaag
agcttattctcagctccaagctccactcacaaggaatgttcaaatcgagctcgggtatgt
tgttctttgccaaatactgatgaatactgcgatgagaaatttgagacgccaatactagac
accattgagactccattgcagttgaagaatttgagtgttaaggagttgaagctattagct
gatgaaatccgtacagagcttcattctgtattatggaagaagacccaaaagtctatgaac
cctagctttgctgctatagagcttacccttgctctgcattatgtttttcgtgccccggtt
gacaatatattgtgggatgctgtggaacaaacatatgcacataaagtcttgacacgacgc
tggtctgcaataccatcgagacaaaagaacggtacttctggggtcacttctcaattggag
agtgaatatgattcttttgggaccggtcatggctgcaacagtacttctgctgggctcgga
ttagcggttgctcgagatataaaaggaaagagggacagagttgttgctgtgatagacaat
gcgacaataactgctggtcaagcatatgaggcaatgagcaatgctggttacttggattct
aatatgattgttatactaaatgatagccgtcactctttacatccaaatatggaggaggga
tccaaggcatccatcagcgcactttctagcatcatgagcaaaatccaatctagcaaaatt
ttccggaaattcagagaattagcaaaatctatgacgaaaagaattggaaagggcatgtat
gaatgggcagccaaagtcgatgagtatgcacgaggtatggttggaccaacaggatcaact
ctttttgaagaacttggtttgtactacattggtcctgttgatggacacaacattgaagat
ctagtttgtgttctccgagaagtatcttctctagattcaatgggtcctgtgctggtccac
gtgatcacagaggaaaatcgagatgcagaaacgggaaagaacatcatggtcaaagacaga
cgcacttacagtgattgctttgttgaggcattggtgatggaggcagaaaaggatagagat
attgttgtagttcatgcaggaatggagatggatgcatcacttattacatttcaggagaga
tttccagacaggtttttcaatgtcggaatggctgaacagcatgctgtcacattctctgct
ggtctttcctctggaggtctcaagcccttttgtattattccctctgcttttctacaaaga
gcttatgaccaggtggtccatgatgtagatcggcagagaaaggcggtgcgatttgttatt
acaagcgcagggcttgttggatccgatggtcctgtgcaatgtggagcttttgacatagct
ttcatgtcatccttaccaaacatgatagccatggctccagccgatgaggatgagcttgta
aatatggttgcaactgcagcttatgtcactgaccgcccagtatgttttcggttccctaga
ggctccatcgtcaacaggaattatcttgtccccactggattaccaattgaaatcggaaga
ggaagagttctcgtagaaggtcaagatgtggctttacttgggtatggagccatggttcag
aattgtcttcatgctcactcgcttctctcgaaactgggtttgaacgtgactgtagctgat
gcaagattttgcaaaccgctagacatcaagcttgtgcgtgatctttgtcagaaccacaaa
atcctcatcactgtcgaagaaggctgtgttggagggttcggttctcatgtggcgcagttc
atagccctcgatggccagctcgatgggaatatcaagtggagaccgattgtgttaccagat
ggctacatcgaagaagcttctcctagggagcagcttgctcttgccgggctaactggacat
cacatagcagcaaccgctctgagtcttttgggacgaactcgggaagcattgcttctcatg
agctag

DBGET integrated database retrieval system