KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_909315Help
Entry
ARALYDRAFT_909315 CDS       T01578                                 

Definition
hypothetical protein
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARALYDRAFT_909315
Enzymes [BR:aly01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ARALYDRAFT_909315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1381 aa AA seqDB search
MASLVYSPFTLSTSKAEHLSSLSNSTKHSFLRKKHRSSKPALSFFKVKSAVSGNGLFTQT
NPEVRRIVPIKRDNVPTVKIVYVVLEAQYQSSLTEAVQSLNKTSRFASYEVVGYLVEELR
DKNTYNHFCEDLKDANIFIGSLIFVEELAIKVKDAVEKERDRMDAVLVFPSMPEVMRLNK
LGSFSMSQLGQSKSPFFQLFKRKKQGSAGFADSMLKLVRTLPKVLKYLPSDKAQDARLYI
LSLQFWLGGSPDNLQNFVKMISGSYVPALKGVKIEYSDPVLFLDTGIWHPLAPTMYDDVK
EYWNWYDTRRDTNDSLKRKDATVVGLVLQRSHIVTGDDSHYVAVIMELEARGAKVVPIFA
GGLDFSGPVEKYFVDPVSKQPIINSAVSLTGFALVGGPARQDHPRAIEALKKLDVPYLVA
VPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGAMEPIVFAGRDPRTGKSHALHKRVEQ
LCIRAIRWGELKRKTKAEKKLAITVFSFPPDKGNVGTAAYLNVFASIFSVLKDLKRDGYN
VEGLPENAETLIEEIIHDKEAQFSSPNLNVAYKMGVREYQDLTPYANALEENWGKPPGNL
NSDGENLLVYGKEYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYSYVEKIFKAD
AVLHFGTHGSLEFMPGKQVGMSDACFPDSLIGNIPNVYYYAANNPSEATIAKRRSYANTI
SYLTPPAENAGLYKGLKQLSELISSYQSLKDTGRGPQIVSSIISTAKQCNLDKDVDLPDE
GAELSPKDRDSVVGKVYSKIMEIESRLLPCGLHVIGEPPSAMEAVATLVNIAALDRPEDD
ISALPSILAECVGREIEDVYRGSDKGILSDVELLKEITDASRGAVSAFVEKTTNSKGQVV
DVSDKLTSLLGFGINEPWVEYLSNTKFYRANRDKLRTVFGFLGECLKLVVMDNELGSLMQ
ALEGKYVEPGPGGDPIRNPKVLPTGKNIHALDPQAIPTTAAMASAKIVVERLVERQKLEN
EGKYPETIALVLWGTDNIKTYGESLGQVLWMIGVRPIADTFGRVNRVEPVSLEELGRPRI
DVVVNCSGVFRDLFINQMNLLDRAIKMVAELDEPVEQNFVRKHALEQAEALGIDIREAAT
RVFSNASGSYSANISLAVENSSWNDEKQLQDMYLSRKSFAFDSDAPGAGMAEKKQVFEMA
LSTAEVTFQNLDSSEISLTDVSHYFDSDPTNLVQSLRKDKKKPSSYIADTTTANAQVRTL
SETVRLDARTKLLNPKWYEGMMSSGYEGVREIEKRLSNTVGWSATSGQVDNWVYEEANST
FIQDEEMLNRLMNTNPNSFRKMLQTFLEANGRGYWDTSAENIEKLKELYSQVEDKIEGID
R
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcttgtgtattctccattcactctatccacttctaaagcagagcatctctct
tcgctctctaacagtaccaaacattctttcctccggaagaaacacagatcgtcaaagcca
gctctatccttcttcaaggtgaaatctgcggtatctggaaacggcctcttcacacagacg
aacccggaggtccggcgtatagttccgatcaagagagacaacgttccgacggtgaaaatc
gtctacgtcgtcctcgaggctcagtaccagtcttctctcaccgaggccgtgcaatctctc
aacaagacttcgagattcgcatcctacgaagtggttggatacttggtagaggagcttcga
gacaagaacacgtacaaccacttctgcgaagaccttaaagacgcaaacatcttcattggt
tctctgatcttcgtcgaggaattggcgattaaagttaaagatgcggtggagaaggagaga
gacaggatggacgcagttcttgtcttcccttcaatgcctgaggtaatgagacttaacaaa
ctcggatctttcagtatgtctcaattgggtcagtcaaagtctccgtttttccaactcttc
aagaggaagaaacaaggctctgctggttttgccgatagtatgttgaagcttgttaggaca
ttgcctaaggttttgaagtacttacctagtgacaaggctcaagatgcccgtctctacatc
ttgagtttacagttttggcttggagggtctcctgataatctccagaatttcgttaagatg
atttctggatcttatgttccggcgttgaaaggtgtcaaaatcgagtattcggatccggtt
ttgttcttggacactggaatttggcatccacttgctcccaccatgtacgacgatgtgaag
gaatactggaactggtatgacacaagaagggacaccaatgactcactcaagaggaaagat
gcaactgttgttgggttggtcttgcagaggagtcacattgtgactggtgatgatagtcac
tatgtggctgttatcatggagcttgaggctagaggcgctaaggttgttcctatattcgca
ggagggttggatttctctggtccagttgagaaatatttcgtagatccagtatcgaaacag
cccattataaactctgctgtctccttgaccggctttgctctagttggtggacctgcaagg
caggatcatccaagggctatcgaagccctgaagaagcttgatgttccttaccttgtggca
gtaccactggtgttccagacgacagaggaatggctaaacagcacacttggtctgcatccc
atccaggtggctctgcaggttgccctccctgagcttgatggagccatggagccaatcgtt
ttcgctggtcgtgaccctagaacagggaagtcacatgctctccacaagagagtggaacaa
ctctgcatcagggctattcgatggggtgagctcaaaagaaaaactaaggcagagaagaag
ctggcaatcactgttttcagtttcccacctgataaaggtaatgtagggactgcagcttac
ctcaacgtgtttgcttccatcttctcggtcctaaaagacctcaagagagatggctacaat
gttgagggccttcctgagaatgcagagactcttattgaagaaatcattcatgacaaggag
gctcagtttagcagtcctaacctcaatgtagcttacaaaatgggagtccgcgagtaccaa
gacctcactccttatgcaaatgccctggaagaaaactggggaaaacctccggggaacctt
aactcagatggagagaatcttctggtctatggaaaagagtatggtaatgttttcatcggt
gtccaaccgacatttggatatgaaggtgatcccatgaggctgcttttctccaaatcagca
agtcctcatcacggttttgctgcttactactcttatgtagaaaagatcttcaaagctgat
gctgtccttcattttggaacacatggttcgctcgagtttatgcccgggaagcaagtagga
atgagcgacgcttgctttccagacagtcttatcggtaacattcccaatgtgtactactac
gcagctaacaatccctctgaagctaccatcgcaaagaggagaagttacgccaacaccatc
agctatttgactcctccagctgagaatgctggtctatacaaagggctgaagcagttgagc
gagctgatatcgtcgtaccagtctctgaaggacacgggaagaggtccacagatcgtcagt
tccatcatcagcacagctaagcaatgtaatcttgataaggatgtggaccttccagatgaa
ggggcggagttgtcacctaaagacagggattctgtggttggaaaagtgtattccaagatt
atggagattgaatcaaggcttttgccgtgcgggcttcacgtcattggagagcctccatcc
gccatggaagctgtggccacactggtcaacattgctgctttagatcgcccggaggatgat
atttcagctcttccttctatattagctgagtgtgttggaagggagatagaggatgtttac
agaggaagtgacaagggtatcttgagcgatgtagagcttctcaaagagatcactgatgca
tcgcgtggcgcggtttccgcctttgttgaaaaaacgacaaatagcaaaggacaggtggtg
gatgtgtctgacaagcttacctcgcttcttgggtttggaatcaatgagccatgggttgag
tatttgtccaacaccaagttttaccgggcgaacagagataagctcagaacagtgtttggt
ttccttggagagtgcctgaagttggtggtcatggacaacgaacttgggagtctaatgcaa
gcgttggaagggaagtacgtcgagccaggacccggaggtgatcccatcagaaacccaaag
gtcttaccaaccggtaaaaacatccatgctttagatcctcaggctattcccacaacagca
gcaatggcaagtgccaagattgtggtcgagaggttggtagagagacagaagctcgagaac
gaagggaaatatcccgagacaatcgcacttgttctttggggaactgacaacattaagaca
tatggggaatctcttgggcaggttctttggatgattggtgtgagaccaattgctgatact
tttggaagagtgaaccgtgtcgagcctgtgagcttagaagaactgggaaggccgaggatc
gatgtagttgttaactgctcaggggtcttccgtgacctctttatcaatcagatgaacctt
cttgaccgagcaatcaagatggtggctgagctagatgagcctgtagagcaaaactttgtg
agaaaacatgcgttggaacaagcagaggcgcttggcattgatattagagaggcagcgaca
agagttttctcaaacgcttcagggtcatactcagccaacatcagtcttgctgttgaaaac
tcttcatggaacgatgagaaacagcttcaggacatgtacttgagccgcaaatcgtttgcg
tttgatagtgatgctcctggagcaggaatggctgagaagaagcaggtctttgagatggct
cttagcactgcagaagtcaccttccagaacctggattcttccgagatttctttgactgat
gtgagccactacttcgactctgacccaacaaatctagttcaaagtttgaggaaggataag
aagaaaccgagctcttacattgctgatacaaccactgcaaatgcacaggtgaggacacta
tctgagacagtgaggctggacgcaagaacaaagctgctgaatccaaagtggtacgaagga
atgatgtcaagtggatatgaaggagttcgtgagatagagaagagactgtcaaacactgtg
ggatggagtgcaacgtccggtcaagtagacaattgggtctacgaggaggccaactcaact
ttcatccaagacgaggagatgcttaaccgtctcatgaacaccaatcccaactccttcagg
aaaatgcttcagactttcttggaggccaatggtcgcggctactgggacacttccgctgaa
aacatcgagaagctcaaggaattgtactcgcaggtggaagacaagattgaagggattgat
agataa

DBGET integrated database retrieval system